Products for Research Use Only
RegisterLogin

Noggin, Human (HEK293)

CAT: 0804-HY-P70558-01Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70558-01Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Noggin Protein is a glycosylated cysteine knot chemokine protein. Noggin is a potent bone morphogenetic protein (BMP) antagonist. Noggin Protein antagonizes BMP4-induced hypertension, inhibits angiogenesis, regulates mesenchymal stem cell differentiation, and maintains embryonic stem cell pluripotency. Noggin Protein, Human (HEK293) is a recombinant Noggin protein produced by HEK293 cells.
Product Name Alternative
Noggin Protein, Human (HEK293), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/noggin-protein-human-hek293.html
Purity
98.0
Smiles
QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
Molecular Formula
9241 (Gene_ID) Q13253 (Q28-C232) (Accession)
Molecular Weight
Approximately 28-33 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Kang HW, et al. In vitro and In vivo imaging of antivasculogenesis induced by Noggin protein expression in human venous endothelial cells. FASEB J. 2009;23 (12) :4126-4134.|[2]Rifas L. The role of noggin in human mesenchymal stem cell differentiation. J Cell Biochem. 2007 Mar 1;100 (4) :824-34.|[3]Chaturvedi G, et al. Noggin maintains pluripotency of human embryonic stem cells grown on Matrigel. Cell Prolif. 2009 Aug;42 (4) :425-33.|[4]Chen C, et al. Noggin suppression decreases BMP-2-induced osteogenesis of human bone marrow-derived mesenchymal stem cells in vitro. J Cell Biochem. 2012 Dec;113 (12) :3672-80.|[5]Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113 (24) :2818-25.Miriyala S, et al. Bone morphogenic protein-4 induces hypertension in mice: role of noggin, vascular NADPH oxidases, and impaired vasorelaxation. Circulation. 2006 Jun 20;113 (24) :2818-25.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P700286-01Noggin, Mouse (HEK293)
HY-P70785-01Noggin, Mouse (HEK293, His)
HY-P73323-01Noggin, Mouse (HEK293, Fc)
HY-P7051A-01Noggin, Human (CHO)
HY-P7086-01Noggin, Mouse (CHO)
HY-P700143AF-01Animal-Free Noggin, Human (His)
HY-P80767-01Noggin Antibody (YA698, Mouse)
HY-P85580Noggin Antibody (YA5272, Mouse)
HY-P701322-01ITIH5 Protein, Human (HEK293, His-hFc),Human,HEK293
HY-P704969Vitronectin, Human (HEK293)

Alternative Products

CatalogName
bs-43122P-01Recombinant human Noggin protein (HEK293)
MBS8113663-01Human Noggin/NOG HEK293 Overexpression Lysate
bs-47167P-01Recombinant human Noggin Protein, Tag free (HEK293)
MBS8116787-01Mouse Noggin/NOG HEK293 Overexpression Lysate
PT_41628-01Noggin Human Recombinant (Noggin Human)
CYT-475-01Noggin Human
HC70039Human Noggin
RC219-20NOGGIN, human
PT_72884-01Noggin Human Recombinant, HEK (Noggin Human, HEK)
MBS7621521-01Recombinant Human Noggin

Popular Products