Products for Research Use Only
RegisterLogin

Recombinant Human Protein SET (SET)

CAT: 0013-GTR19127469-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19127469-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Recombinant Human Protein SET (SET) spans the amino acid sequence from region 2-290. Purity: Greater than 85% as determined by SDS-PAGE.
Product Name Alternative
Protein SET; HLA-DR-associated protein II; Inhibitor of granzyme A-activated DNase; IGAAD; PHAPII; Phosphatase 2A inhibitor I2PP2A; I-2PP2A; Template-activating factor I; TAF-I; SET
UniProt
Q01105
Expression Region
2-290
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
APKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD

Related Products

CatalogName
GTR19137692-01Recombinant Human SET Protein, N-His
GTR19117481-01Recombinant Human SET Protein, N-His
GTR19073581-01Recombinant Human SET Protein, N-His
GTR18980774-01Human SET Protein
GTR18887984-01Human SET protein
GTR18989948-01Human SET-binding Protein
GTR19011907-01Protein SET
GTR19011369-01Protein SET
GTR19011830-01Protein SET
GTR19028735-01Recombinant Human SET and MYND domain-containing protein 3 (SMYD3)

Alternative Products

CatalogName
BLT-02752P-01Human SET (Protein Set) - Recombinant Protein
R14249hHuman SET / Protein SET Recombinant Protein
ATGP2191-500Recombinant human SET protein
PROTQ01105-01Human SET Recombinant Protein
RP028225SET Recombinant Protein (Human)
TP307606MSET (NM_003011) Human Recombinant Protein
R14249mMouse Set / Protein SET Recombinant Protein
R14249rRat Set / Protein SET Recombinant Protein
MBS1470844-01Recombinant Rat Protein SET (Set)
MBS1415635-01Recombinant Mouse Protein SET (Set)

Popular Products