Products for Research Use Only
RegisterLogin

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial (Active)

CAT: 0013-GTR19122486-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19122486-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial spans the amino acid sequence from region 22-182aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Name Alternative
T-cell surface glycoprotein CD8 alpha chain; T-lymphocyte differentiation antigen T8/Leu-2; CD8a; CD8A; MAL
UniProt
P01732
Expression Region
22-182aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human CD8A at 5 μg/mL can bind Anti-CD8A recombinant antibody. The EC50 is 11.49-20.78 ng/mL.
Form
Lyophilized powder
Molecular Weight
19.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

UniProtKB · P01732

T-cell surface glycoprotein CD8 alpha chain

CD8A_HUMAN · Homo sapiens

View on UniProt ↗
Primary accession
P01732
Review status
UniProtKB reviewed (Swiss-Prot)
Gene
CD8A
Protein existence
1: Evidence at protein level
Organism
Homo sapiens (Human)
Taxonomy ID
9606
Alternative names
—
EC number
—
Processing
Precursor
Secondary accessions
B4DT80, D6W5M8, Q13970, Q4ZG17
Protein keywords

Technical term

3D-structureProteomics identificationReference proteome

Biological process

Adaptive immunityImmunity

Coding sequence diversity

Alternative splicing

Cellular component

Cell membraneMembraneSecreted

Disease

Disease variant

PTM

Disulfide bondGlycoproteinLipoproteinPalmitate

Domain

Immunoglobulin domainSignalTransmembraneTransmembrane helix

Related Products

CatalogName
GTR19024987-01Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial
GTR19078460-01Recombinant Rat T-cell surface glycoprotein CD8 alpha chain (Cd8a)
GTR19078439-01Recombinant Dog T-cell surface glycoprotein CD8 alpha chain (CD8A)
GTR19078438-01Recombinant Cat T-cell surface glycoprotein CD8 alpha chain (CD8A)
GTR19123155-01Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial
GTR19025569-01Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial
GTR19078429-01Recombinant Mouse T-cell surface glycoprotein CD8 alpha chain (Cd8a)
GTR19150013-01Recombinant Mouse T-cell surface glycoprotein CD8 alpha chain (Cd8a), partial
GTR19027921-01Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A), partial
GTR19025083-01Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A), partial

Alternative Products

CatalogName
CSB-MP004966HUd7-01Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial (Active)
abx691615Mouse T-Cell Surface Glycoprotein CD8 Alpha Chain (CD8a) Protein (Active)
CSB-AP005431HURecombinant Human Inhibin beta C chain (INHBC), partial (Active)
MBS968456-01Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial
MBS9423424-01Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A), partial
MBS7111390Recombinant Cat T-cell surface glycoprotein CD8 alpha chain (CD8A), partial
MBS7111393Recombinant Rat T-cell surface glycoprotein CD8 alpha chain (Cd8a), partial
MBS7111392Recombinant Mouse T-cell surface glycoprotein CD8 alpha chain (Cd8a), partial
AP73324-01Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A), partial
AP73844Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain (CD8A) , partial

Popular Products