Recombinant Uncharacterized protein Mb2011c (Mb2011c)

CAT: 0013-GTR19105498-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19105498-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Recombinant Uncharacterized protein Mb2011c (Mb2011c) spans the amino acid sequence from region 1-186.

Product Name Alternative

Uncharacterized protein Mb2011c

UniProt

P64908

Expression Region

1-186

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLA DSAQACMVEVERAAQAASTTAEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDI YGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQRTRPGQLQLRQSVDLTPALY QELRAT

UniProtKB · P64908

NAD(+) phosphorylase MbcT

MBCT_MYCBO · Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

View on UniProt ↗

Primary accession: P64908
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: mbcT
Protein existence: 3: Inferred from homology
Organism: Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Taxonomy ID: 233413
Alternative names: —
EC number: 2.4.2.-
Processing: —
Secondary accessions: A0A1R3Y0A4, Q10869, X2BJ76

Protein keywords

Ligand

NAD

Molecular function

NucleotidyltransferaseTransferase

Technical term

Reference proteome

Biological process

Toxin-antitoxin system

Related Products

Catalog	Name
GTR19111668-01	Recombinant Uncharacterized protein Mb2101c (Mb2101c)
GTR19102953-01	Recombinant Uncharacterized protein Mb2102c (Mb2102c)
GTR19103968-01	Recombinant Uncharacterized protein Mb2118c (Mb2118c)
GTR19080726-01	Recombinant Uncharacterized protein Mb2601c (Mb2601c)
GTR19089905-01	Recombinant Uncharacterized protein ORF2
GTR19026384-01	Recombinant Uncharacterized protein (CE2118)
GTR19087483-01	Recombinant Uncharacterized protein Mb1372 (Mb1372)
GTR19086443-01	Recombinant Uncharacterized protein ycf92 (ycf92)
GTR19083874-01	Recombinant Uncharacterized protein Mb0088 (Mb0088)
GTR19064542-01	Recombinant Cricetulus griseus Uncharacterized protein

Alternative Products

Catalog	Name
MBS7040980-01	Recombinant Uncharacterized protein Mb2011c (Mb2011c)
MBS7062055	Recombinant Mycobacterium bovis Uncharacterized protein Mb2011c (Mb2011c), partial
VAng-Yyj3049-inquire	Recombinant Mycobacterium Bovis Mb2011c Protein (aa 1-186)
580838-01	Uncharacterized Protein
MBS7042379-01	Uncharacterized protein C21orf63
MBS7042374-01	Uncharacterized protein C18orf1
A49463-100UL	Uncharacterized protein Antibody
AP84527-01	Uncharacterized protein KIAA1377
339078-01	Uncharacterized Protein C4orf3
580840-01	Uncharacterized Protein (FITC)