Recombinant Rat CD81 antigen (Cd81)

CAT: 0013-GTR19092989-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19092989-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Recombinant Rat CD81 antigen (Cd81) spans the amino acid sequence from region 1-236.

Product Name Alternative

CD81 antigen, 26 kDa cell surface protein TAPA-1, Target of the antiproliferative antibody 1, CD_antigen= CD81

UniProt

Q62745

Expression Region

1-236

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGVEGCTKCIKYLLFVFNFVFWLAGGVILGVALWLRHDPQTTTLLYLELGDKPAPSTFYV GIYILIAVGAVMMFVGFLGCYGAIQESQCLLGTFFTCLVILFACEVAAGIWGFVNKDQIA KDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNTLTTLTTAVLRNSLCPSSSN SFTQLLKEDCHQKIDELFSGKLYLIGIAAIVVAVIMIFEMILSMVLCCGIRNSSVY

UniProtKB · Q62745

CD81 antigen

CD81_RAT · Rattus norvegicus

View on UniProt ↗

Primary accession: Q62745
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: Cd81
Protein existence: 1: Evidence at protein level
Organism: Rattus norvegicus (Rat)
Taxonomy ID: 10116
Alternative names: —
EC number: —
Processing: —
Secondary accessions: —

Protein keywords

Biological process

Adaptive immunityImmunity

Cellular component

Cell membraneMembrane

Technical term

Direct protein sequencingReference proteome

PTM

Disulfide bond

Ligand

Lipid-binding

Domain

TransmembraneTransmembrane helix

Related Products

Catalog	Name
GTR19092993-01	Recombinant Bovine CD81 antigen (CD81)
GTR18867924-01	Rat CD81 Antigen (Cd81) ELISA Kit
GTR18876450-01	Rat CD81 (CD81 antigen) ELISA Kit
GTR19027925-01	Recombinant Human CD81 antigen (CD81), partial
GTR19064990-01	Recombinant Mouse CD81 antigen (Cd81), partial
GTR19092977-01	Recombinant Pan troglodytes CD81 antigen (CD81)
GTR19092973-01	Recombinant Chlorocebus aethiops CD81 antigen (CD81)
GTR19027923-01	Recombinant Mouse CD81 antigen (Cd81), partial
GTR19026089-01	Recombinant Human CD81 antigen (CD81), partial
GTR19033416-01	Recombinant Human CD81 antigen (CD81), partial (Active)

Alternative Products

Catalog	Name
477543	CD81 (CD81 Antigen
477544	CD81 (CD81 Antigen, CD81 Molecule)
MBS7038674-01	Recombinant Mouse CD81 antigen (Cd81)
MBS7011186-01	Recombinant Rat CD81 antigen (Cd81)
MBS7011183-01	Recombinant Bovine CD81 antigen (CD81)
abx455618-01	CD81 Antigen (CD81) Antibody
CSB-EP004960MO-01	Mouse CD81 antigen (Cd81)
MBS9021435-01	Recombinant Mouse CD81 antigen (Cd81), partial
MBS7011185-01	Recombinant Pan troglodytes CD81 antigen (CD81)
RPC24578-01	Recombinant Human CD81 antigen (CD81), partial