Recombinant Human CD81 antigen (CD81), partial

CAT:
617-RPC24578-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human CD81 antigen (CD81), partial - image 1

Recombinant Human CD81 antigen (CD81), partial

  • Description :

    Recombinant Human CD81 antigen (CD81), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens) . Target Name: CD81. Target Synonyms: 26 kDa cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28; Tspan-28; CD81. Accession Number: P60033. Expression Region: 113~201aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 11.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
  • Short Description :

    Recombinant Human CD81 antigen (CD81), partial is a purified Recombinant Protein.
  • Accession Number :

    P60033
  • Expression Region :

    113~201aa
  • Host :

    Yeast
  • Target :

    CD81
  • Conjugation :

    Unconjugated
  • Tag :

    N-Terminal 6Xhis-Tagged
  • Field of Research :

    Immunology
  • Endotoxin :

    Not Tested
  • Purity :

    >90% by SDS-PAGE
  • Activity :

    Not Tested
  • Length :

    Partial
  • Buffer :

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution :

    Refer to the datasheet/CoA included in the product pouch.
  • Molecular Weight :

    11.8kDa
  • Shipping Conditions :

    Ice packs
  • Storage Conditions :

    -20°C. Avoid repeated freeze/thaw cycles.
  • Target Alternative Name :

    26 kDa cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28; Tspan-28; CD81
  • Species :

    Human (Homo sapiens)
  • Protein Name :

    Recombinant Protein
  • CAS Number :

    9000-83-3
  • AA Sequence :

    FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide