Recombinant Protein translocase subunit SecF (secF)

CAT: 0013-GTR19085662-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR19085662-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Recombinant Protein translocase subunit SecF (secF) spans the amino acid sequence from region 1-315.

Product Name Alternative

Protein translocase subunit SecF

UniProt

E9RGS4

Expression Region

1-315

Origin

Vibrio alginolyticus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFQILKAEKTIGFMRWSKVAFVFSIFMIAASIFTLSTKWLNWGLDFTGGTLIEVGFEKPA NLEKIRTALDAKGFGDATVQNFGSAREVMVRLRPRDDVSGETLGNQIIGAIKDGTGESVE MRRIEFVGPNVGDELTEAGGLAILVSLICILLYVSMRFEWRLAAGAVMALAHDIIITLGV FSFLQIEVDLTIVAALLTVVGYSLNDTIVVFDRIRENFRKMRKGEPADIMDASITQTLSR TLITSGTTLFVVIALFMQGGAMIHGFATALLLGITVGTYSSIYVASALALKLGIQKEHLM PPQVEKEGAEFDEMP

UniProtKB · E9RGS4

Protein translocase subunit SecF

SECF_VIBAL · Vibrio alginolyticus

View on UniProt ↗

Primary accession: E9RGS4
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: secF
Protein existence: 1: Evidence at protein level
Organism: Vibrio alginolyticus
Taxonomy ID: 663
Alternative names: —
EC number: —
Processing: —
Secondary accessions: —

Protein keywords

Cellular component

Cell membraneMembrane

Biological process

Protein transportTranslocationTransport

Domain

TransmembraneTransmembrane helix

Related Products

Catalog	Name
GTR19087101-01	Recombinant Methanoplanus petrolearius Protein translocase subunit SecF (secF)
GTR19086664-01	Recombinant Methanopyrus kandleri Protein translocase subunit SecF (secF)
GTR19086479-01	Recombinant Synechococcus sp. Protein translocase subunit SecF (secF)
GTR19086413-01	Recombinant Aquifex aeolicus Protein translocase subunit SecF (secF)
GTR19086190-01	Recombinant Rhodobacter sphaeroides Protein translocase subunit SecF (secF)
GTR19085950-01	Recombinant Petrotoga mobilis Protein translocase subunit SecF (secF)
GTR19085940-01	Recombinant Rickettsia bellii Protein translocase subunit SecF (secF)
GTR19085822-01	Recombinant Rickettsia akari Protein translocase subunit SecF (secF)
GTR19085821-01	Recombinant Rickettsia rickettsii Protein translocase subunit SecF (secF)
GTR19085681-01	Recombinant Desulfurispirillum indicum Protein translocase subunit SecF (secF)

Alternative Products

Catalog	Name
MBS7029525-01	Recombinant Protein translocase subunit SecF (secF)
MBS7029505-01	Recombinant Elusimicrobium minutum Protein translocase subunit SecF (secF)
MBS7029504-01	Recombinant Dictyoglomus turgidum Protein translocase subunit SecF (secF)
MBS7029502-01	Recombinant Calditerrivibrio nitroreducens Protein translocase subunit SecF (secF)
MBS7029501-01	Recombinant Borrelia burgdorferi Protein translocase subunit SecF (secF)
MBS7029548-01	Recombinant Treponema pallidum Protein translocase subunit SecF (secF)
MBS7029545-01	Recombinant Thermobaculum terrenum Protein translocase subunit SecF (secF)
MBS7029542-01	Recombinant Streptomyces coelicolor Protein translocase subunit SecF (secF)
MBS7029519-01	Recombinant Petrotoga mobilis Protein translocase subunit SecF (secF)
MBS7029517-01	Recombinant Methanopyrus kandleri Protein translocase subunit SecF (secF)