Urocortin III, mouse (TFA)
CAT:
804-HY-P1858A-02
Size:
5 mg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Urocortin III, mouse (TFA)
- UNSPSC Description: Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2[1]. Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics[2].
- Target Antigen: CRFR
- Type: Peptides
- Related Pathways: GPCR/G Protein
- Applications: Metabolism-protein/nucleotide metabolism
- Field of Research: Neurological Disease; Cardiovascular Disease; Endocrinology
- Assay Protocol: https://www.medchemexpress.com/urocortin-iii-mouse-tfa.html
- Purity: 95.27
- Solubility: H2O : 25 mg/mL (ultrasonic)
- Smiles: [FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 (TFA salt)]
- Molecular Weight: 4172.97 (free base)
- References & Citations: [1]Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7570-5. Lewis K, et al. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor. Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor.|[2]Shemesh Y, et al. Ucn3 and CRF-R2 in the medial amygdala regulate complex social dynamics. Nat Neurosci. 2016 Nov;19(11):1489-1496.
- Shipping Conditions: Blue Ice
- Storage Conditions: -80°C, 2 years; -20°C, 1 year (Powder, sealed storage, away from moisture)
- Clinical Information: No Development Reported