Products for Research Use Only

BNP-32, human

CAT: 0013-GTR19068690-01Size: 250 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19068690-01Size:250 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
B-type (Brain) natriuretic peptide (BNP) is a 32 amino acid hormone initially isolated from the porcine brain, but mainly produced by the heart ventricles. It is released from a prepro-hormone after cleavage of a signal peptide and further processing by a protease with a conserved recognition sequence (RXXR-S) . This cleavage generated NT-proBNP (76aa) and the biologically active 32aa BNP-32, which are secreted in blood in equimolar concentrations. BNP-32 is secreted by cardiomyocytes in response to myocardial stretch and overload resulting from hypervolaemia and increased blood pressure. It is known to oppose the renin-angiotensin-aldosterone system and exert vasodilatory effects. This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides.
Purity
≥95%
Molecular Weight
3464.1
Notes
For research use only.
AA Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)

Popular Products