Products for Research Use Only
RegisterLogin

CART (1-39), Human, Rat

CAT: 0013-GTR19067237-01Size: 250 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19067237-01Size:250 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
CART (1-39), Human, Rat is a neuropeptide consisting of 1-39 residues of the CART peptide. CART (1-39), Human, Rat is a rat satiety factor with potent appetite-suppressing activity and is closely associated with leptin and neuropeptide Y. CART (1-39), Human, Rat inhibits both normal and starvation-induced feeding. CART (1-39), Human, Rat can induce anxiety and stress-related behavior.
Field of Research
Neuroscience
Purity
≥95%
Molecular Weight
4369.76
Notes
For research use only.
AA Sequence
{Glp}-EDAELQPRALDIYSAVDDASHEKELPRRQLRAPGAVLQ

Related Products

CatalogName
GTR19067216-01CART (62-102), human, rat
GTR19067232-01CART (55-76), rat
GTR19067221-01CART (55-102), rat
GTR19036183-01CART (55-76), rat
GTR19036768-01CART (62-76) (human, rat) TFA
GTR18891279Rat ACTH (1-39) peptide
GTR19034778-01Big endothelin-1 (rat 1-39)
GTR19068547-01ACTH (1-39), mouse, rat
GTR18894525ACTH (1-39) (human)
GTR18919054-01ACTH (1-39) human

Alternative Products

CatalogName
003-63CART (1-39) (Human, Rat)
HY-P3691CART (1-39), Human, Rat
H-003-63CART (1-39) (Human, Rat) - Antibody
301916CART , aa1-39, Human/Rat
G-003-63CART (1-39) (Human, Rat) - Purified IgG Antibody
WBK-003-63CART (1-39) (Human, Rat) - Western Blot Kit
DBK-003-63CART (1-39) (Human, Rat) - Dot Blot Kit
T-003-63CART (1-39) (Human, Rat) - I-125 Labeled
FG-G-003-63ACART (1-39) (Human, Rat) - FAM Labeled Purified IgG
B-G-003-63CART (1-39) (Human, Rat) - Biotin Labeled Purified IgG

Popular Products