Products for Research Use Only

MCRAMP, mouse

CAT: 0013-GTR19066503-02Size: 10 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19066503-02Size:10 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
MCRAMP (mouse) or mouse calethicidin-related antimicrobial peptide, is the sole murine cathelicidin and intestinal homologue of human LL-37. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon where it exhibits antimicrobial activity against enteric pathogens and it is established as a component of the innate antimicrobial defense in mice. mCRAMP deficiency has been linked to alcoholic liver disease (ALD) in mice and it also produces viral-induced responses in mouse cells. mCRAMP synergises wirh rifamycin for intracellular killing of mycobacteria.
Purity
≥95%
Molecular Weight
3878.7
Notes
For research use only.
AA Sequence
GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ