Products for Research Use Only
RegisterLogin

Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)

CAT: 0013-GTR19064066-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR19064066-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Recombinant Human Leukocyte surface antigen CD47 (CD47), partial spans the amino acid sequence from region 19-139aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Name Alternative
Antigenic surface determinant protein OA3 (Integrin-associated protein) (IAP) (Protein MER6) (CD47)
UniProt
Q08722
Expression Region
19-139aa
Tag
C-terminal 10xHis-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation; Cell Biology
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
1Measured by its binding ability in a functional ELISA. Immobilized Human CD47 at 2 μg/mL can bind Human SIRPA protein. The EC50 is 98.73-112.7 ng/mL. 2Measured by its binding ability in a functional ELISA. Immobilized Human CD47 at 2 μg/mL can bind Anti-CD47 recombinant antibody. The EC50 is 1.343-1.561 ng/mL.
Form
Lyophilized powder
Molecular Weight
15.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

UniProtKB · Q08722

Leukocyte surface antigen CD47

CD47_HUMAN · Homo sapiens

View on UniProt ↗
Primary accession
Q08722
Review status
UniProtKB reviewed (Swiss-Prot)
Gene
CD47
Protein existence
1: Evidence at protein level
Organism
Homo sapiens (Human)
Taxonomy ID
9606
Alternative names
—
EC number
—
Processing
Precursor
Secondary accessions
A8K198, D3DN59, Q53Y71, Q96A60
Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Coding sequence diversity

Alternative splicing

Biological process

AngiogenesisApoptosisCell adhesionInflammatory response

Cellular component

Cell membraneMembrane

PTM

Disulfide bondGlycoproteinPhosphoproteinPyrrolidone carboxylic acid

Domain

Immunoglobulin domainSignalTransmembraneTransmembrane helix

Related Products

CatalogName
GTR19123494-01Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active)
GTR19122464-01Recombinant Human Leukocyte surface antigen CD47 (CD47), partial, Biotinylated
GTR19031940-01Recombinant Human Leukocyte surface antigen CD47 (CD47), partial, Biotinylated
GTR19091701-01Recombinant Pig Leukocyte surface antigen CD47 (CD47)
GTR19091700-01Recombinant Bovine Leukocyte surface antigen CD47 (CD47)
GTR19091709-01Recombinant Mouse Leukocyte surface antigen CD47 (Cd47)
GTR19091698-01Recombinant Rat Leukocyte surface antigen CD47 (Cd47)
GTR19091231-01Recombinant Pongo abelii Leukocyte surface antigen CD47 (CD47)
GTR18814863-01Mouse CD47 (Leukocyte surface antigen CD47) ELISA Kit
GTR18876452-01Rat CD47 (Leukocyte surface antigen CD47) ELISA Kit

Alternative Products

CatalogName
CSB-AP005201HU-01Recombinant Human Leukocyte surface antigen CD47 (CD47), partial (Active)
RPC28043-01Recombinant Human Leukocyte surface antigen CD47 (CD47), partial, Active Protein
RPC28921-01Recombinant Human Leukocyte surface antigen CD47 (CD47), partial , Active Protein
CSB-MP6802MOW-01Recombinant Macaca mulatta Leukocyte surface antigen CD47 (CD47), partial (Active)
abx692377Rat Leukocyte Surface Antigen Cd47 (CD47) Protein (Active)
MBS7115118-01Recombinant Human Leukocyte Surface Antigen CD47 (CD47), Partial
MBS7115132-01Recombinant Mouse Leukocyte Surface Antigen CD47 (Cd47), Partial
MBS7111362Recombinant Rat Leukocyte surface antigen CD47 (Cd47), partial
MBS7101432Recombinant Bovine Leukocyte surface antigen CD47 (CD47), partial
MBS7099712Recombinant Pig Leukocyte surface antigen CD47 (CD47), partial

Popular Products