Products for Research Use Only

RecombinantTRAIL/Apo2L, Human

CAT: 0013-GTR18990451-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990451-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
TRAIL/Apo2L, also known as Tumor Necrosis Factor Super-Family 10 (TNFSF10), is a pleiotropic cytokine thatbelongs to the TNF superfamily. The full length TRAIL expressed in vivo is a Type II transmembrane protein, although the soluble form also exists and functions. TRAIL has four major receptors: two death receptors DR4 and DR5, two decoy receptors DcR1 and DcR2. TRAIL binds to the death receptors, recruits the FAS-associated death domain, activates caspases 8 and 10, and eventually leads to apoptosis. Because of its antitumor potential, TRAIL is actively studied as a therapeutic agent. On the other hand, abnormal expression of TRAIL in small arteries can induce the proliferation of smooth muscle cells, resulting in increasing vascular remodeling and pulmonary arterial hypertension. Recombinant human TRAIL/Apo2L (rhTRAIL) produced in E.coli is a single non-glycosylated polypeptide chain containing 169 amino acids. A fully biologically active molecule, rhTRAIL has a molecular mass of 19.6 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques at GenScript.
Product Name Alternative
TNF-related apoptosis-inducing Ligand, TNFSF10, Apo2 Ligand, TL2
Source
Escherichia coli.
Field of Research
Cell Biology
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE and HPLC.
Bioactivity
ED50 2.5 x 10ˆ4 units/mg.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
19.6 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant human TRAIL/Apo2L (rhTRAIL) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhTRAIL remains stable up to 2 weeks at 4°C or up to 3 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
MVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGE LVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSK DAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG