Products for Research Use Only
RegisterLogin

RecombinantTNFRI, Human

CAT: 0013-GTR18990252-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990252-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
TNF Receptor Type I, is also known as TNF R-p55/p60 and TNFRSF1A. It is a type I transmembrane protein member of the TNF receptor superfamily. It is expressed in most cell types. Binding of either TNF-α or TNF-β to TNF-R1 initiates a signal transduction pathway that results in the activation of the transcription factor NF-κB, whose target genes are involved in the regulation of inflammatory responses, and, in certain cells, induce apoptosis. TNF-R1 is essential for proper development of lymph node germinal centers and Peyer’s patches and for combating intracellular pathogens such as Listeria. It is stored in the Golgi and translocates to the cell surface following proinflammatory stimuli.
Product Name Alternative
Soluble Tumor Necrosis Factor type I, TNFRSF1A, TNFAR, TNF-R55, TNFR60, p55, CD120a
Source
CHO
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
ED50 < 50 ng/ml, measured in a cell proliferation assay using 929 cells in the presence of 1 ng/ml human TNF-α.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
28~35 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human TNF Receptor Type I remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human TNF Receptor Type I should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIE N

Related Products

CatalogName
GTR18990453-01RecombinantTNF-α, Human
GTR18990454-01RecombinantTNF-α, His, Human
GTR18990194-01RecombinantTNF-α, Human (P.pastoris-expressed)
GTR18990192-01RecombinantTNF-α, Rat
GTR18990455-01RecombinantTNF-α, Bovine
GTR18990452-01RecombinantTNF-α, RhesusMacaque
GTR18990193-01RecombinantTNF-α, Mouse (P.pastoris-expressed)
GTR18777889-01Human Human CYP19A1 Antibody
GTR18882498-01Human human Septin-7 protein
GTR18880605-01Human Human Septin-7 protein

Alternative Products

CatalogName
BK0287RecombinantTNFRI,Human
BK0287-01RecombinantTNFRI, Human
P83251PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
P81559PCMV-Twinstrep-UFM1 (human) -UFM1 (human-opt-human) -UFM1 (human-opt-human) -Neo
P1493-200Human CellExp™ Human Serum Albumin, Human Recombinant
9230-10Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
PT_75080-01Adiponectin Human (Acrp30 Human)
PT_42362-01Urokinase Human (Urokinase Human)
PT_42243-01Human Thrombin (Thrombin Human)
PT_41408-01Leuprolide Human (Leuprorelin Human)

Popular Products