Products for Research Use Only
RegisterLogin

RecombinantFasR, Human

CAT: 0013-GTR18990239-01Size: 1 mgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18990239-01Size:1 mg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Fas Receptor and Fas Ligand (FasL) belong to the TNF superfamily and are type I and type II transmembrane proteins, respectively. Binding of FasL to Fas triggers apoptosis in Fas-bearing cells. The mechanism of apoptosis involves recruitment of pro-caspase 8 through an adaptor molecule called FADD followed by processing of the pro-enzyme to active forms. These active caspases then cleave various cellular substrates leading to the eventual cell death. sFasR is capable of inhibiting FasL-induced apoptosis by acting as a decoy receptor that serves as a sink for FasL.
Product Name Alternative
Soluble Fas receptor (sFasR), TNFRSF6, CD95, Apo I, Fas Antigen
Source
HEK 293
Endotoxin
< 0.2 EU/μg, determined by LAL method.
Purity
> 95% as analyzed by SDS-PAGE.
Bioactivity
ED50 < 0.4 μg/ml, measured by its ability to inhibit the cytotoxicity of Jurkat cells in the presence of 20ng/ml of human Fas Ligand.
Form
Lyophilized after extensive dialysis against PBS.
Molecular Weight
17~29 kDa, observed by reducing SDS-PAGE.
Storage Conditions
Lyophilized recombinant Human Fas Receptor remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Fas Receptor should be stable up to 1 week at 4°C or up to 2 months at -20°C.
Notes
For research use only.
Applications Notes
Reconstituted in ddH2O or PBS at 100 μg/ml.
Preservative
Lyophilized after extensive dialysis against PBS.
AA Sequence
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCR LCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRS

Related Products

CatalogName
GTR18990187-01RecombinantFGFR-1α (IIIc) -Fc, Human
GTR18777889-01Human Human CYP19A1 Antibody
GTR18882498-01Human human Septin-7 protein
GTR18880605-01Human Human Septin-7 protein
GTR18834069-01Human Human Macrosialin ELISA Kit
GTR19008890-01Human BDNF (BDNF Human) protein
GTR18698434-01HuMax-IL8 Human Monoclonal Antibody
GTR18698323-01HuMax-IL15 Human Monoclonal Antibody
GTR17702017Rabbit Human Sirt1 Protein (Human) Antibody
GTR18877893Human Human IgG3 Lambda G3M (G)

Alternative Products

CatalogName
BK0303RecombinantFasR,Human
BK0303-01RecombinantFasR, Human
P83251PMG36e-ADH1B (human-opt-human) -ALDH2 (human-opt-human)
P81559PCMV-Twinstrep-UFM1 (human) -UFM1 (human-opt-human) -UFM1 (human-opt-human) -Neo
P1493-200Human CellExp™ Human Serum Albumin, Human Recombinant
9230-10Human CellExp™ Human CD40/ TNFRSF5, Human recombinant
PT_75080-01Adiponectin Human (Acrp30 Human)
PT_42362-01Urokinase Human (Urokinase Human)
PT_42243-01Human Thrombin (Thrombin Human)
PT_41408-01Leuprolide Human (Leuprorelin Human)

Popular Products