Products for Research Use Only
RegisterLogin

Human IL 1 beta Protein

CAT: 0013-GTR18985170-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18985170-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of Human IL 1 beta protein
Product Name Alternative
Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Source
HEK
Purity
Greater than 95% as obsereved by SDS-PAGE.
Bioactivity
The specific activity was determined by the dose-dependent stimulation of the proliferation of mouse D10S cells and is typically 0.02-0.08ng/ml.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized IL-1b in sterile PBS containing 0.1% endotoxin-free recombinant HSA.
Storage Conditions
Stability: Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
The IL-1 beta was lyophilized from 1mg/ml in 1xPBS.
AA Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Related Products

CatalogName
GTR18985165-01IL 1 beta Protein
GTR18985171-01Human IL 1 beta (His) Protein
GTR19319364-01Interleukin-1 Beta (IL-1 Beta), Human
GTR19149847-01Human IL-1 beta / IL-1F2 Protein, Research Grade
GTR18911697-01IL-1 beta Recombinant Protein
GTR18908756IL-1 beta Recombinant Protein
GTR18906625-01Canine IL-1 beta protein
GTR18906622-01Feline IL-1 beta protein
GTR18906616-01Bovine IL-1 beta protein
GTR18906597-01Rabbit IL-1 beta protein

Alternative Products

CatalogName
MBS189697-01Human TNF beta Protein
abx060120Human beta HCG Protein
E2PD201141Human beta-NGF Protein
MBS9718672-01Human TNF-beta Protein
MBS9719443-01Human TGF-beta protein
MBS9718689-01Human IFN-beta Protein
abx657948-01Human Beta-Hexosaminidase Subunit Beta (HEXB) Protein
R1151hHuman Beta-APP42 / Beta-amyloid protein 42 Recombinant Protein
CD00952-01Recombinant Human SDF-1 Beta/CXCL12 Beta protein
HCG15-N-100Purified Human Chorionic Gonadotropin beta (HCG, beta) protein

Popular Products