Products for Research Use Only
RegisterLogin

IL 1 beta Protein

CAT: 0013-GTR18985165-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18985165-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of IL 1 beta protein
Product Name Alternative
Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta.
Source
Escherichia Coli
Purity
Greater than 96.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Bioactivity
The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Cytokines And Growth Factors
Preservative
The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4, 5% trehalose and 0.02 % Tween-20.
AA Sequence
MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS

Related Products

CatalogName
GTR18911697-01IL-1 beta Recombinant Protein
GTR18908756IL-1 beta Recombinant Protein
GTR18911833-01IL-1 beta Recombinant Protein
GTR18911823-01IL-1 beta Recombinant Protein
GTR18909699IL-1 beta Recombinant Protein
GTR18985171-01Human IL 1 beta (His) Protein
GTR18985167-01Mouse IL 1 beta (His) Protein
GTR18222186IL-1B/IL-1 Beta Antibody
GTR18222183IL-1B/IL-1 Beta Antibody
GTR18303074IL-1 beta Antibody

Alternative Products

CatalogName
MBS633046-01S100 Protein, beta, beta
S0052-14-PES100 Protein, beta, beta (PE)
S0052-14-BiotinS100 Protein, beta, beta (Biotin)
S0052-14-APCS100 Protein, beta, beta (APC)
MBS6128974-01S100 Protein, beta, beta (HRP)
MBS628742-01COP, beta (Coatomer Protein beta)
S0052-14-FITCS100 Protein, beta, beta (FITC)
S0052-15S100 Protein, beta, beta discontinued
MBS6126498-01S100 Protein, beta, beta (AP)
MBS6248422-01beta-Amyloid Protein 42, beta (Beta-amyloid Protein 42, Ab42) (Biotin)

Popular Products