Products for Research Use Only
RegisterLogin

Ag85B Protein

CAT: 0013-GTR18982796-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18982796-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of Ag85B protein
Product Name Alternative
Antigen 85-B, 85B, Extracellular alpha-antigen, Antigen 85 complex B, Ag85B, Mycolyl transferase 85B, EC 2.3.1.-, Fibronectin-binding protein B, 30 kDa extracellular protein, fbpB, A85B, Major Secretory Protein Antigen 85B.
Source
Escherichia Coli
Purity
Greater than 90.0% as determined by SDS-PAGE.
Form
Sterile Filtered and lyophilized, though might appear as a solution as a result of the glycerol content.
Solubility
It is recommended to reconstitute the lyophilized Antigen-85B in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Ag85B although stable room temperature for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Recombinant & Natural Proteins
Preservative
Lyophilized with no additives.
AA Sequence
MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG

Related Products

CatalogName
GTR17857604Ag85b (M. tuberculosis) Antibody
GTR18200444Mycobacterium tuberculosis Ag85B Polyclonal Antibody
GTR19143914-01Recombinant M.tuberculosis Ag85B/fbpB protein, N-His
GTR18798026-01M.tuberculosis Ag85B/fbpB Rabbit pAb
GTR18226431Mycobacterium tuberculosis Ag85B Polyclonal Antibody HRP Conjugated
GTR18876317-01Human Ag85B (Mycobacterium tuberculosis Antigen 85B) ELISA Kit
GTR19064638-01Recombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB)
GTR19021940-01Recombinant Mycobacterium kansasii Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB)
GTR19021694-01Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB)
GTR19064684-01Recombinant Mycobacterium bovis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB)

Alternative Products

CatalogName
MBS8506690-01Ag85b Protein
32-3165-10Ag85B Recombinant Protein
TMPH-03006-01Ag85B Protein, Mycobacterium tuberculosis, Recombinant (His)
bs-41043P-01Recombinant Mycobacterium tuberculosis Ag85b protein, Tag free
QP10977-0.1mgRecombinant other Ag85B Protein, His, E.coli-100ug
QP7004-ye-10ugRecombinant M. tuberculosis Ag85B Protein, His, Yeast-10ug
QP7004-ye-50ugRecombinant M. tuberculosis Ag85B Protein, His, Yeast-50ug
QP7004-ye-100ugRecombinant M. tuberculosis Ag85B Protein, His, Yeast-100ug
QP10977-10ugRecombinant other Ag85B Protein, His, E.coli-10ug
QP7004-ye-200ugRecombinant M. tuberculosis Ag85B Protein, His, Yeast-200ug

Popular Products