Products for Research Use Only
RegisterLogin

Ag85B Recombinant Protein

CAT: 0793-32-3165-10Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0793-32-3165-10Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Source : Escherichia Coli. Ag85B Recombinant His-Tag fusion protein produced in E.Coli is a single, non-glycosylated polypeptide chain having a molecular mass of 30kDa. Antigen 85B Mycobacterium Tuberculosis-is the most abundant protein exposed by M. Tuberculosis, as well as a potent immunoprotective antigen and a leading drug target. Ag85 induces strong T-cell proliferation and IFN-g secretion in most healthy individuals exposed to M. tuberculosis, in BCG-vaccinated mice and humans, whereas the antibody against Ag85 are more prevalent in active tuberculosis patients with decreased cellular immune response.
Product Name Alternative
Antigen 85-B||85B||Extracellular alpha-antigen||Antigen 85 complex B||Ag85B||Mycolyl transferase 85B||EC 2.3.1.-||Fibronectin-binding protein B||30 kDa extracellular protein||fbpB||A85B||Major Secretory Protein Antigen 85B.
Purification
Greater than 90.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Components
Lyophilized with 0.1% glycerol.
Storage Conditions
Ag85B although stable room temperature for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.
Applications Notes
It is recommended to reconstitute the lyophilized Antigen-85B in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Amino Acids
MRGSHHHHHHFSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG.

Related Products

CatalogName
30-2673-0.1Anti-Ag85b (M. tuberculosis) Antibody
32-3164-10Ag85A Recombinant Protein
32-4513-10Recombinant Protein L
32-3516-20CFL2 Recombinant Protein
32-3507-20CENPP Recombinant Protein
32-3506-10CENPM Recombinant Protein
32-3505-20CENPH Recombinant Protein
32-3502-20CEND1 Recombinant Protein
32-3499-20CEACAM21 Recombinant Protein
32-3494-20CDC123 Recombinant Protein

Alternative Products

CatalogName
TMPH-03006-01Ag85B Protein, Mycobacterium tuberculosis, Recombinant (His)
bs-41043P-01Recombinant Mycobacterium tuberculosis Ag85b protein, Tag free
QP10977-0.1mgRecombinant other Ag85B Protein, His, E.coli-100ug
QP7004-ye-10ugRecombinant M. tuberculosis Ag85B Protein, His, Yeast-10ug
QP7004-ye-50ugRecombinant M. tuberculosis Ag85B Protein, His, Yeast-50ug
QP7004-ye-100ugRecombinant M. tuberculosis Ag85B Protein, His, Yeast-100ug
QP10977-10ugRecombinant other Ag85B Protein, His, E.coli-10ug
GTR19143914-01Recombinant M.tuberculosis Ag85B/fbpB protein, N-His
QP7004-ye-200ugRecombinant M. tuberculosis Ag85B Protein, His, Yeast-200ug
QP7004-ye-1mgRecombinant M. tuberculosis Ag85B Protein, His, Yeast-1mg

Popular Products