Products for Research Use Only
RegisterLogin

Human CD14 (HEK) Protein

CAT: 0013-GTR18982536-01Size: 10 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18982536-01Size:10 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
Recombinant of human CD14 (HEK) protein
Product Name Alternative
Monocyte differentiation antigen CD14, Myeloid cell-specific leucine-rich glycoprotein, CD14.
Source
HEK293 cells
Field of Research
Immunology & Inflammation
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Sterile Filtered White lyophilized (freeze-dried) powder.
Solubility
It is recommended to reconstitute the lyophilized CD14 in 1xPBS to a concentration no less than 100 μg/ml, which can then be further diluted to other aqueous solutions.
Storage Conditions
Stability: Lyophilized CD14 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CD14 should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles
Notes
For research use only.
Applications Notes
Recombinant & Natural Proteins
Preservative
CD14 was lyophilized from a 0.2 μM filtered solution of 20mM PB and 150mM NaCl, pH 7.4.
AA Sequence
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACVDHHHHHH

Related Products

CatalogName
GTR18985576-01Human ANGPTL4 (HEK) Protein
GTR18985183-01Human IL1A (HEK) Protein
GTR18984826-01Human Myostatin (HEK) Protein
GTR18982434-01Human PTX3 (HEK) Protein
GTR18982274-01Human COMP (HEK) Protein
GTR18982126-01Human DKK3 (HEK) Protein
GTR18982074-01Human EFNA1 (HEK) Protein
GTR18982001-01Human ESM1 (HEK) Protein
GTR18981800-01Human GPNMB (HEK) Protein
GTR18981701-01Human ICAM1 (HEK) Protein

Alternative Products

CatalogName
abx260650-01CD14, HEK Protein
PT-A00726-01CD14 Human HEK
PROTP08571-1CD14 Human Recombinant Protein HEK
32-3442-50CD14 HEK Recombinant Protein
MBS146148-01Recombinant Human CD14, HEK
rAP-0004CD14 Human Recombinant HEK
117532Human Akt1 Protein (HEK)
117525Human Chitinase protein (HEK)
PR27030-50CD14 Human Protein
PT_74514-01Cartilage Oligomeric Matrix Protein HEK Human Recombinant (COMP HEK Human)

Popular Products