Recombinant Human CD81 antigen (CD81), partial (Active)

CAT:
399-CSB-MP004960HUd7-01
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human CD81 antigen (CD81), partial (Active) - image 1

Recombinant Human CD81 antigen (CD81), partial (Active)

  • Product Name Alternative:

    TAPA1; TSPAN28
  • Abbreviation:

    Recombinant Human CD81 protein, partial (Active)
  • Gene Name:

    CD81
  • UniProt:

    P60033
  • Expression Region:

    113-201aa
  • Organism:

    Homo sapiens (Human)
  • Target Sequence:

    FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
  • Tag:

    C-terminal 10xHis-tagged
  • Type:

    Active Protein & In Stock Protein
  • Source:

    Mammalian cell
  • Field of Research:

    Cancer
  • Relevance:

    Structural component of specialized membrane microdomains known as tetraspanin-enriched microdomains (TERMs), which act as platforms for receptor clustering and signaling. Essential for trafficking and compartmentalization of CD19 receptor on the surface of activated B cells.
  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.
  • Purity:

    Greater than 95% as determined by SDS-PAGE.
  • Activity:

    Yes
  • Bioactivity:

    Measured by its binding ability in a functional ELISA. Immobilized Human CD81 at 2 μg/mL can bind Anti-CD81 recombinant antibody (CSB-RA004960MA1HU), the EC50 is 4.166-5.578 ng/mL.
  • Form:

    Lyophilized powder
  • Buffer:

    Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight:

    11.1 kDa
  • References & Citations:

    "TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins." Oren R., Takahashi S., Doss C., Levy R., Levy S. Mol. Cell. Biol. 10:4007-4015 (1990)
  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
  • Protein Length:

    Partial