Products for Research Use Only

Human HLA-DRB1 protein

CAT: 0013-GTR18886299-01Size: 20 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18886299-01Size:20 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
This Human HLA-DRB1 protein spans the amino acid sequence from region 31-266aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Name Alternative
Human leukocyte antigen DRB1; HLA-DRB1
UniProt
P01912
Expression Region
31-266aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
31.1 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
DTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS

UniProtKB · P01911

HLA class II histocompatibility antigen, DRB1 beta chain

DRB1_HUMAN · Homo sapiens

View on UniProt ↗
Primary accession
P01911
Review status
UniProtKB reviewed (Swiss-Prot)
Gene
HLA-DRB1
Protein existence
1: Evidence at protein level
Organism
Homo sapiens (Human)
Taxonomy ID
9606
Alternative names
—
EC number
—
Processing
Precursor
Secondary accessions
A0MWF2, A0N0W1, A2ICT1, A2TGX3, A4F5N0, A4ZXA5, A4ZXA6, A4ZY86, A5H000, A5HKN8, A7DZP9, A7LA26, A7UHG2, A7X5B1, A7X5B7, A7X5E0, A7X5E6, A7X5H8, A7X5J4, A7X5K7, A8K098, A8YQE9, A9JPG0, B0BK85, B0LUZ6, B0UYW1, B1GWE7, B2CR03, B2LVF9, B2NJ29, B2ZCY1, B3VTP8, B3VTQ3, B5A8Y2, B5A8Y3, B5B8U0, B5B9V5, B5B9V6, B5LZ25, B5QSK8, B6VCX2, B6VEL9, B7UDB2, B9VRA4, B9X248, C0LAB5, O02876, O02930, O19585, O19717, O19718, O19739, O19788, O46699, O46793, O46872, O62869, O62889, O77969, O78047, O78210, O98212, P01912, P01914, P04229, P13758, P13759, P13760, P13761, P20039, P79545, Q06662, Q0PGR5, Q0PQ39, Q14280, Q14QT2, Q155F7, Q19AF2, Q19K86, Q1AP33, Q1G0Z9, Q1JRP3, Q1KLJ6, Q27PR6, Q27PR7, Q29673, Q29720, Q29722, Q29734, Q29770, Q29771, Q29772, Q29790, Q29792, Q29800, Q29806, Q29833, Q29874, Q29875, Q29886, Q29968, Q29974, Q29975, Q2A120, Q2HZE5, Q2L9H4, Q2LE76, Q2MF40, Q2MJA6, Q2MZ92, Q2VQU1, Q2YHQ2, Q30006, Q30108, Q30112, Q30115, Q30116, Q30117, Q30120, Q30134, Q30142, Q30145, Q30149, Q30159, Q30166, Q30167, Q30200, Q307W5, Q31636, Q32MY7, Q3HUP9, Q3KTM1, Q3LA84, Q3LA87, Q3LA88, Q3LA89, Q3LA90, Q3LA91, Q3LA92, Q3LA93, Q3LA94, Q3LA95, Q3LA96, Q3LA97, Q3LA98, Q3LA99, Q3LAA0, Q3LAA1, Q3LAA2, Q3MQ60, Q3T919, Q4PRC3, Q4PRC5, Q4VZY7, Q53IG1, Q56FN9, Q56FP1, Q56FP2, Q56FP3, Q58F52, Q5BM92, Q5EER6, Q5K3W2, Q5NDB9, Q5U9W6, Q5UBA2, Q5UT58, Q5W3L4, Q5Y7A7, Q5Y7B0, Q5Y7B9, Q5Y7E9, Q5Y7G0, Q683P7, Q6REE2, Q6T865, Q6U387, Q701T1, Q70GL2, Q70Q85, Q768U2, Q768U4, Q7M2H4, Q7YNY9, Q7YP03, Q7YP04, Q7YQ26, Q7YQA3, Q7YQA5, Q860D8, Q860D9, Q860E5, Q860H8, Q860S0, Q860Z3, Q861G6, Q861H0, Q861H4, Q861H5, Q861H7, Q861H8, Q8HWQ6, Q8MH59, Q8MH60, Q8WLU3, Q8WMA0, Q95348, Q95383, Q95389, Q95461, Q95HK1, Q95HL0, Q95HL1, Q95IE3, Q95IG2, Q95IT6, Q96HZ9, Q9BCL7, Q9BCP0, Q9BCP1, Q9BCP2, Q9BCP5, Q9BD21, Q9BD33, Q9BD40, Q9GIK5, Q9GIL5, Q9GIL6, Q9GIP3, Q9GIX8, Q9GIX9, Q9GIY0, Q9GIY1, Q9GIY2, Q9GIY3, Q9GIY4, Q9GJ25, Q9GJ56, Q9GJ57, Q9GJ58, Q9GJ60, Q9GJF8, Q9GJF9, Q9GJG0, Q9MXZ0, Q9MXZ5, Q9MY13, Q9MY45, Q9MY56, Q9MYF5, Q9TPB6, Q9TPW1, Q9TPW3, Q9TPW9, Q9TPX4, Q9TQ37, Q9TQ91, Q9TQE0, Q9UBY1, Q9UIM9, Q9UIN0, Q9XRX1, Q9XRY4, Q9XRY5, Q9Y453, Q9Y4H7
Protein keywords

Technical term

3D-structureDirect protein sequencingProteomics identificationReference proteome

Biological process

Adaptive immunityImmunity

Cellular component

Cell membraneCytoplasmic vesicleEndoplasmic reticulumEndosomeLysosomeMembraneMHC II

PTM

Disulfide bondGlycoproteinIsopeptide bondUbl conjugation

Domain

SignalTransmembraneTransmembrane helix