Horse IL1B protein (Active)

CAT: 0013-GTR18881635-01Size: 10 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18881635-01Size:10 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Horse IL1B protein (Active) spans the amino acid sequence from region 116-268aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Product Name Alternative

Interleukin-1 beta Short name: IL-1 beta

UniProt

Q28386

Expression Region

116-268aa

Tag

Tag-Free

Source

E.Coli

Origin

Equus caballus (Horse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

> 95% as determined by SDS-PAGE and HPLC.

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using murine D10S cells is less than 20 pg/ml, corresponding to a specific activity of > 5.0 x 10 ^ 7 IU/mg.

Form

Lyophilized powder

Molecular Weight

17.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm filtered PBS, pH 7.4, 0.1 % Tween-80

AA Sequence

AAMHSVNCRLRDIYHKSLVLSGACELQAVHLNGENTNQQVVFCMSFVQGEEETDKIPVALGLKEKNLYLSCGMKDGKPTLQLETVDPNTYPKRKMEKRFVFNKMEIKGNVEFESAMYPNWYISTSQAEKSPVFLGNTRGGRDITDFIMEITSA

UniProtKB · Q28386

Interleukin-1 beta

IL1B_HORSE · Equus caballus

View on UniProt ↗

Primary accession: Q28386
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: IL1B
Protein existence: 2: Evidence at transcript level
Organism: Equus caballus (Horse)
Taxonomy ID: 9796
Alternative names: IL-1 beta
EC number: —
Processing: Precursor
Secondary accessions: O18995, O77744

Protein keywords

Coding sequence diversity

Alternative splicing

Molecular function

CytokineMitogenPyrogen

Cellular component

CytoplasmLysosomeSecreted

Biological process

Inflammatory response

Technical term

Reference proteome

Related Products

Catalog	Name
GTR19025421-01	Recombinant Horse Interleukin-1 beta protein (IL1B) (Active)
GTR18881545-01	Mouse IL1B protein (Active)
GTR18881538-01	Monkey IL1B protein (Active)
GTR18881504-01	Human IL1B protein (Active)
GTR18881646-01	Horse IL1RA protein (Active)
GTR19025422-01	Recombinant Mouse Interleukin-1 beta protein (Il1b) (Active)
GTR19025420-01	Recombinant Human Interleukin-1 beta protein (IL1B) (Active)
GTR18811914-01	Horse Interleukin 1 Beta (IL1b) ELISA Kit
GTR18851383-01	Horse Interleukin-1 beta (IL1B) ELISA Kit
GTR19122914-01	Recombinant Human Interleukin-1 beta (IL1B) (Active)

Alternative Products

Catalog	Name
RPU59856-01	Horse Interleukin 1 Beta (IL1b), Active Protein
MBS969466-01	Recombinant Horse Interleukin-1 beta protein (IL1B) (Active)
RPC28855-01	Recombinant Horse Interleukin-1 beta protein (IL1B), Active Protein
IL1B-1167C	Active Recombinant Cynomolgus IL1B Protein
IL1B-132H	Active Recombinant Human IL1B Protein
Il1b-383M	Active Recombinant Mouse Il1b protein
RPU60717-01	Horse Prolactin, Active Protein
abx656363-01	Horse Interleukin-1 Beta (IL1B) Protein
abx262251-01	Horse Interleukin 1 Beta (IL1B) Protein
RPU60735-01	Horse Interleukin 6, Active Protein