Bacterial pat protein

CAT: 0013-GTR18881329-01Size: 20 µgDry Ice: NoHazardous: No

1 / 1

CAT#:0013-GTR18881329-01Size:20 µg

Selected

24/48H Stock Items & 2 to 6 Weeks non Stock Items.

Quick Request Actions

Description

This Bacterial pat protein spans the amino acid sequence from region 1-183aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Name Alternative

Phosphinothricin-resistance protein

UniProt

Q57146

Expression Region

1-183aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Streptomyces viridochromogenes

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPERRPVEIRPATAADMAAVCDIVNHYIETSTVNFRTEPQTPQEWIDDLERLQDRYPWLVAEVEGVVAGIAYAGPWKARNAYDWTVESTVYVSHRHQRLGLGSTLYTHLLKSMEAQGFKSVVAVIGLPNDPSVRLHEALGYTARGTLRAAGYKHGGWHDVGFWQRDFELPAPPRPVRPVTQI

UniProtKB · Q57146

Phosphinothricin N-acetyltransferase

PAT_STRVT · Streptomyces viridochromogenes (strain DSM 40736 / JCM 4977 / BCRC 1201 / Tue 494)

View on UniProt ↗

Primary accession: Q57146
Review status: UniProtKB reviewed (Swiss-Prot)
Gene: pat
Protein existence: 1: Evidence at protein level
Organism: Streptomyces viridochromogenes (strain DSM 40736 / JCM 4977 / BCRC 1201 / Tue 494)
Taxonomy ID: 591159
Alternative names: PPT N-acetyltransferase
EC number: 2.3.1.183
Processing: —
Secondary accessions: —

Protein keywords

Molecular function

AcyltransferaseTransferase

Biological process

Antibiotic resistanceHerbicide resistance

Technical term

Genetically modified food

Related Products

Catalog	Name
GTR18883299-01	Bacterial CLPP2 protein
GTR18883264-01	Bacterial NADB protein
GTR18883260-01	Bacterial PLCH protein
GTR18883243-01	Bacterial APT protein
GTR18883207-01	Bacterial HLB protein
GTR18883156-01	Bacterial DEGS protein
GTR18883154-01	Bacterial PLY protein
GTR18883098-01	Bacterial NFUA protein
GTR18883066-01	Bacterial FBPB protein
GTR18883065-01	Bacterial RECR protein

Alternative Products

Catalog	Name
HY-NP016-01	Brucella bacterial protein
GWB-PS6392	Bacterial Protein Extraction Buffer
HY-NP022	Mycobacterium bovis bacterial protein
BC3750-01	Bacterial Protein Extraction Kit
TRP-00173-01	E.coli Bacterial protein
MBS400001-01	Bacterial outer membrane protein A
abx263222-01	Bacterial Outer Membrane Protein-A Protein
AR0157	Complete Bacterial Protein Extraction Reagent
8001-500	EZLys™ Bacterial Protein Extraction Reagent
32-4373-200	Recombinant Bacterial Outer Membrane Protein-A