Products for Research Use Only
RegisterLogin

Recombinant Mouse IL-1 beta

CAT: 0013-GTR18881357Size: 5 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0013-GTR18881357Size:5 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE) . This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Mouse IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.
Source
Yeast
Field of Research
Immunology & Inflammation
Form
Lyophilized
Molecular Weight
17.4 kDa
Storage Conditions
-20°C
Notes
For research use only.
Applications Notes
The Mouse APRIL protein can be used in cell culture, such as an APRIL ELISA Standard, and as a Western Blot Control.
AA Sequence
VPIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVAL GLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNW YISTSQAEHKPVFLGNNSGQDIIDFTMESVSS (152)

Related Products

CatalogName
GTR18895238-01Recombinant IL-1 beta (Interleukin-1 beta), Mouse, Animal-Free
GTR18880567Recombinant Human IL-1 beta
GTR18911697-01IL-1 beta Recombinant Protein
GTR18908756IL-1 beta Recombinant Protein
GTR18911833-01IL-1 beta Recombinant Protein
GTR18911823-01IL-1 beta Recombinant Protein
GTR18909699IL-1 beta Recombinant Protein
GTR18602663-01IL-1 beta Mouse mAb
GTR18907490-01Mouse IL-1 beta protein
GTR18985169-01Mouse IL 1 beta Protein

Alternative Products

CatalogName
P1160-.1Recombinant Mouse IL-1 beta
401-mL-005Recombinant Mouse IL-1 beta/IL-1F2
32-7035-10Recombinant Mouse Interleukin-1 beta/IL-1 beta
PT_41126-01Interleukin-1 beta Mouse Recombinant (IL 1 beta Mouse)
228351IL-1 beta, Recombinant, Mouse (Interleukin 1 beta, IL1B, IL-1F2)
OPSD00152-2UGRecombinant IL-1 beta
PROTP10749-10ugMouse IL-1 beta /IL-1F2 Recombinant Protein
TMPY-02134-01IL-1 beta/IL-1F2 Protein, Mouse, Recombinant
NBP2-35109-10ugRecombinant Mouse IL-1 beta/IL-1F2 Protein
401-mL-025/CFRecombinant Mouse IL-1 beta/IL-1F2 CF

Popular Products