Products for Research Use Only
RegisterLogin

IL-12, Mouse (HEK293)

CAT: 0804-HY-P70666-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P70666-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
IL-12 protein is a immune-suppressive heterodimeric cytokine, composed by IL-12A subunit (IL-12p35) and IL-12B subunit (IL-12p40), is naturally produced by dendritic cells[1]. IL-12 exerts functions to activate and link the innate and acquired immune responses[2]. IL-12 Protein, Mouse is produced in HEK293 cells, with tag free.
Product Name Alternative
IL-12 Protein, Mouse (HEK293), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/il-12-protein-mouse-hek293.html
Purity
98.0
Smiles
RVIPVSGPARCLSQSRNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRGSCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELMQSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA&:MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Molecular Formula
16159&16160 (Gene_ID) P43431 (R23-A215) &P43432 (M23-S335) (Accession)
Molecular Weight
Approximately 20-28 kDa & 35-55 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
References & Citations
[1]Kaliński P, et al. IL-12-deficient dendritic cells, generated in the presence of prostaglandin E2, promote type 2 cytokine production in maturing human naive T helper cells. J Immunol. 1997 Jul 1;159 (1) :28-35.|[2]Wolf SF, et al. Interleukin 12: a key modulator of immune function. Stem Cells. 1994 Mar;12 (2) :154-68.|[3]Mattner F, et al. Genetically resistant mice lacking interleukin-12 are susceptible to infection with Leishmania major and mount a polarized Th2 cell response. Eur J Immunol. 1996 Jul;26 (7) :1553-9.|[4]Vignali DA, et al. IL-12 family cytokines: immunological playmakers. Nat Immunol. 2012 Jul 19;13 (8) :722-8.|[5]Bacon CM, et al. Interleukin 12 (IL-12) induces tyrosine phosphorylation of JAK2 and TYK2: differential use of Janus family tyrosine kinases by IL-2 and IL-12. J Exp Med. 1995 Jan 1;181 (1) :399-404.|[6]Cua DJ, et al. Interleukin-23 rather than interleukin-12 is the critical cytokine for autoimmune inflammation of the brain. Nature. 2003 Feb 13;421 (6924) :744-8.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P73161IL-12 beta, Mouse (HEK293)
HY-P7032-01IL-12, Human (HEK293)
HY-P72597-01IL-12 beta, Mouse (HEK293, His)
HY-P73162IL-12 beta, Mouse (HEK293, Fc)
HY-P701008-01IL-12, Cynomolgus (HEK293, His)
HY-P72598-01IL-12, Rat (HEK293, His)
HY-P7032GGMP IL-12, Human (HEK293)
HY-P70617-01IL-12 beta, Human (HEK293)
HY-P73898-01IL-12, Human (HEK293, His)
HY-P701009IL-12 beta, Cynomolgus (HEK293, His)

Alternative Products

CatalogName
MBS8118077-01Mouse IL-12 HEK293 Overexpression Lysate
bs-47129P-01Recombinant human IL-23 alpha & mouse IL-12 beta Protein, C-His-Avi (HEK293)
TMPS-00062-01IL-11 Protein, Mouse, Recombinant (HEK293)
MBS8118081-01Mouse IL-23 HEK293 Overexpression Lysate
MBS8116472-01Mouse IL-13 HEK293 Overexpression Lysate
MBS8116510-01Mouse IL-6R HEK293 Overexpression Lysate
MBS8116333-01Mouse IL-34 HEK293 Overexpression Lysate
MBS8117047-01Mouse IL-27 HEK293 Overexpression Lysate
TMPY-02554U-01IL-5 Protein, Mouse, Recombinant (HEK293, His)
TMPY-05221U-01IL-9 Protein, Mouse, Recombinant (HEK293, His)

Popular Products