Login

Recombinant Human Ankyrin-3 (ANK3) , partial

CAT:
399-CSB-MP619642HU-01
Size:
20 µg
Price:
Ask
For price, please contact [email protected]
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Recombinant Human Ankyrin-3 (ANK3) , partial - image 1
Recombinant Human Ankyrin-3 (ANK3) , partial - image 2
Thumbnail 1
Thumbnail 2

Recombinant Human Ankyrin-3 (ANK3) , partial

  • CAS Number: 9000-83-3
  • Gene Name: ANK3
  • UniProt: Q12955
  • Expression Region: 4088-4199aa
  • Organism: Homo sapiens
  • Target Sequence: ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG
  • Tag: C-terminal hFc-tagged
  • Source: Mammalian cell
  • Field of Research: Neuroscience
  • Assay Type: Developed Protein
  • Relevance: In skeletal muscle, required for costamere localization of DMD and betaDAG1 . Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments. Regulates KCNA1 channel activity in function of dietary Mg (2+) levels, and thereby contributes to the regulation of renal Mg (2+) reabsorption . [Isoform 5]: May be part of a Golgi-specific membrane cytoskeleton in association with beta-spectrin.
  • Purity: Greater than 90% as determined by SDS-PAGE.
  • Activity: Not Test
  • Length: Partial
  • Form: Liquid or Lyophilized powder
  • Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
  • Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
  • Molecular Weight: 41.5 kDa
  • References & Citations: "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399 (2007)
  • Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.