Recombinant Human Ankyrin-3 (ANK3), partial

Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Dry Ice Shipment: No

Alternative Products

Cat	Name
MBS556084-02	Ankyrin 3/Ankyrin G
CH22125	Ankyrin 3/Ankyrin G
MBS555975-01	Ankyrin 3/Ankyrin G
MBS555975-02	Ankyrin 3/Ankyrin G
MBS556084-01	Ankyrin 3/Ankyrin G
MBS1389931-02	Recombinant Human Ankyrin-3 (ANK3) , partial
MBS1389931-03	Recombinant Human Ankyrin-3 (ANK3) , partial
MBS1389931-01	Recombinant Human Ankyrin-3 (ANK3) , partial
MBS1389931-04	Recombinant Human Ankyrin-3 (ANK3) , partial
MBS1389931-05	Recombinant Human Ankyrin-3 (ANK3) , partial

CAT:

399-CSB-EP619642HU-02

Size:

100 µg

Price:

Ask

For price, please contact [email protected].

Recombinant Human Ankyrin-3 (ANK3), partial

Gene Name: ANK3
UniProt: Q12955
Expression Region: 4088-4199aa
Organism: Homo sapiens
Target Sequence: ERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDG
Tag: N-terminal 6xHis-tagged
Source: E.coli
Field of Research: Neuroscience
Assay Type: Developed Protein
Relevance: In skeletal muscle, required for costamere localization of DMD and betaDAG1. Membrane-cytoskeleton linker. May participate in the maintenance/targeting of ion channels and cell adhesion molecules at the nodes of Ranvier and axonal initial segments. Regulates KCNA1 channel activity in function of dietary Mg (2+) levels, and thereby contributes to the regulation of renal Mg (2+) reabsorption.; [Isoform 5]: May be part of a Golgi-specific membrane cytoskeleton in association with beta-spectrin.
Purity: Greater than 90% as determined by SDS-PAGE.
Activity: Not Test
Length: Partial
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight: 18.6 kDa
References & Citations: "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399 (2007)
Storage Conditions: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Complementary Product Range

Our range of products, including Recombinant Human Ankyrin-3 (ANK3), partial, falls within the same field of application and can be used across various research projects. These products are carefully selected for their high performance and reliability, supporting the diverse needs of modern laboratories. Whether for ongoing studies or future experiments, they are designed to help researchers achieve their scientific goals. Here are some related products that may be of interest for similar or future applications:

Each item in our collection, is tested for precision and quality, ensuring dependable solutions for your research. As we continue to incorporate the latest advancements, Gentaur ensures that our product range remains relevant and versatile, providing you with the tools needed for both current and future projects.

Find us on

Cat	Name
CSB-MP619642HU-03	Recombinant Human Ankyrin-3 (ANK3), partial
CSB-MP619642HU-01	Recombinant Human Ankyrin-3 (ANK3), partial
CSB-EP619642HU-03	Recombinant Human Ankyrin-3 (ANK3), partial
CSB-EP619642HU-02	Recombinant Human Ankyrin-3 (ANK3), partial
CSB-YP619642HU-01	Recombinant Human Ankyrin-3 (ANK3), partial
CSB-EP619642HU-01	Recombinant Human Ankyrin-3 (ANK3), partial
CSB-YP619642HU-03	Recombinant Human Ankyrin-3 (ANK3), partial
CSB-MP619642HU-02	Recombinant Human Ankyrin-3 (ANK3), partial
CSB-YP619642HU-02	Recombinant Human Ankyrin-3 (ANK3), partial
CSB-EP819458HU-03	Recombinant Human Fibronectin type 3 and ankyrin repeat domains protein 1 (FANK1)