Products for Research Use Only
RegisterLogin

Protein E7, HPV16 (His)

CAT: 0804-HY-P72259-01Size: 2 µgDry Ice: NoHazardous: No
Product image 1
1 / 1
CAT#:0804-HY-P72259-01Size:2 µg
Selected
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Quick Request Actions
Description
HPV16 E7 is a viral phosphoprotein with oncogenic activity, belonging to the human papillomavirus early protein family. HPV16 E7 activates the cell cycle by releasing E2F through proteasome degradation of pRB. HPV16 E7 can cooperate with E6 to immortalize cells and neutralize the toxicity of E5, while activating the AP-1/NF-κB pathway and downregulating E-cadherin to enhance migration and invasion, making it a core target for cervical cancer. Protein E7, HPV (His) is a recombinant HPV E7 protein expressed from E. coli with an N-6*His tag.
Product Name Alternative
Protein E7, HPV16 (His), Virus, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/protein-e7-human-his.html
Purity
98.0
Smiles
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
Molecular Formula
1489079 (Gene_ID) P03129 (M1-P98) (Accession)
Molecular Weight
Approximately 18-21 kDa
References & Citations
[1]Pahel G, et al. Structural and functional characterization of the HPV16 E7 protein expressed in bacteria. J Biol Chem. 1993 Dec 5;268 (34) :26018-25.|[2]Boulenouar S, et al. Effects of HPV-16 E5, E6 and E7 proteins on survival, adhesion, migration and invasion of trophoblastic cells. Carcinogenesis. 2010 Mar;31 (3) :473-80.|[3]Li YL, et al. Vaccination of full-length HPV16 E6 or E7 protein inhibits the growth of HPV16 associated tumors. Oncol Rep. 2010 Nov;24 (5) :1323-9.|[4]Poo H, et al. Oral administration of human papillomavirus type 16 E7 displayed on Lactobacillus casei induces E7-specific antitumor effects in C57/BL6 mice. Int J Cancer. 2006 Oct 1;119 (7) :1702-9.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins

Related Products

CatalogName
HY-P1778HPV16 E7 (86-93)
HY-P702859Protein E7, HPV18 (His)
HY-P1778A-01HPV16 E7 (86-93) (TFA)
HY-P70393-01HLA-A*0201 HPV16 E7 complex, Human (YMLDLQPET, HEK293, His)
HY-P700917HLA-A*0201 HPV16 E7 complex, Human (YMLDLQPET, HEK293, His-Avi)
HY-P72260-01Protein E6, HPV16 (His)
HY-P705356-01HLA-A*1101 HPV16-E7 Complex, Human (Biotinylated, KITDFGRAK, HEK293, His-Avi)
HY-P700916HLA-A*0201 HPV16 E7 complex, Human (Biotinylated, YMLDLQPET, HEK293, His-Avi)
HY-P700918HLA-A*0201 HPV16 E7 complex Tetramer, Human (YMLDLQPET, HEK293, His-Avi)
HY-P705369-01HLA-B*0702 HPV16 E7 Complex, Human (Biotinylated, KPTLKEYVL, HEK293, His-Avi)

Alternative Products

CatalogName
PE7-V5143-100ugHPV16 E7 Protein, His Tag
PE6-V5144-1mgHPV16 E6 Protein, His Tag
VK451032-01HPV16 E6 Recombinant Protein (C-His)
ARO-P18461-01HPV16 E2 Recombinant Protein, N-His
GTR19146557-01Recombinant HPV16 E6 Protein, C-His
GTR19146556-01Recombinant HPV16 L2 Protein, N-His
GTR19008278-01Recombinant HPV16 E7 protein, DsbC & His
GTR19146451-01Recombinant HPV16 E2 Protein, N-His
VK042012-01HPV16 E2 Recombinant Protein (N-His)
VK658022-01HPV16 L2 Recombinant Protein (N-His)

Popular Products