VEGF-B167

• Description:

  VEGF-B, a member of the VEGF family, is a potent growth and angiogenic cytokine. It promotes DNA synthesis in endothelial cells, helps regulate angiogenesis and vascular permeability, and inhibits apoptosis in certain smooth muscle cells and neurons. VEGF-B is expressed in all tissues except the liver. It forms cell surfaced-associated disulfide linked homodimers and can form heterodimers with VEGF-A. There are two known isoforms, formed by alternative splicing, which have been designated VEGF-B167 and VEGF-B186. Both forms have identical amino-terminal sequences encoding a “cysteine knot” like structural motif, but differ in their carboxyl-terminal domains. Both VEGF-B isoforms signal only through the VEGFR1 receptor. Recombinant human VEGF-B is a 38.0 kDa disulfide-linked homodimeric protein consisting of two 167 amino acid polypeptide chains.

• Synonyms:

  Vascular endothelial growth factor B; VEGFB; VRF; VEGFL

• NCBI Gene ID:

  7423

• UniProt:

  P49765

• Accession Number:

  NP_003368.1

• Accession Number mRNA:

  NM_003377.4

• Chromosomal Location:

  11q13

• Reactivity:

  Human

• Cross Reactivity:

  Human

• Sequence:

  MPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVELMGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHSQCECRPKKKDSAVKPDSPRPLCPRCTQHHQRPDPRTCRCRCRRRSFLRCQGRGLELNPDTCRCRKLRR

• Assay Protocol:

  The lyophilized VEGF-B167 should be reconstituted in water to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.

• Endotoxin:

  < 0.1 ng/µg of protein (< 1EU/µg)

• Purity:

  > 98% by SDS-PAGE & Coomassie stain

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized human sVEGFR-1/Flt-1 at 1 µg/mL (100 µL/well) can bind rhVEGF-B167 with a linear range of 0.5 ng/mL to 12.5 ng/mL.

• Length:

  167

• Form:

  Lyophilized

• Buffer:

  50mM acetic acid

• Reconstitution:

  Water

• Molecular Weight:

  38 kDa

• Storage Conditions:

  Lyophilized samples are stable for greater than six months at –20°C to –70°C. Reconstituted VEGF-B167 should be stored in working aliquots at -20°C.

• Host or Source:

  E. coli

• N Terminal Sequence:

  MPVSQ