VEGF164 Recombinant Protein
CAT:
209-M30-002
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

VEGF164 Recombinant Protein
- Description: Mouse Vascular Endothelial Growth Factor164 (VEGF164), a 24 kDa protein consisting of 164 amino acid residues, is produced as a homodimer. VEGF164 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF164 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1). Consistent with the endothelial cell-specific action of VEGF164, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemoattractant for monocytes and endothelial cells. At least three different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. VEGF is apparently a homodimer, but preparations of VEGF show some heterogenity on SDS gels depending of the secretion of different forms and the varying degrees of glycosylation. All dimeric forms possess similar biological activities. There is evidence that heterodimeric molecules between the different isoforms exist and that different cells and tissues express different VEGF isoforms. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities.
- Synonyms: vascular endothelial growth factor A; Vegfa;Vpf; Vegf; Vegf164
- CAS Number: 9000-83-3
- NCBI Gene ID: 22339
- UniProt: Q00731
- Accession Number: NP_001020421
- Accession Number mRNA: NM_001025250
- Gene Location: 17C; 17 24.2cM
- Host: Insect Cells
- Origin Species: Mouse
- Species Reactivity: Mouse
- Sequence: APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
- Detection Range: The ED50 for stimulation of cell proliferation by human umbilical vein endothelial cells for VEGF164 has been determined to be in the range of 1-5 ng/ml.
- Purity: > 95% by SDS-PAGE
- Length: 164
- Form: Lyophilized
- Buffer: 50mM acetic acid
- Reconstitution: The lyophilized VEGF164 should be reconstituted in 50 mM acetic acid to a concentration not lower than 50 µg/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
- Molecular Weight: 48.0 kDa
- Shipping Conditions: Room Temperature
- Storage Conditions: Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF164 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!