VEGF120

• Description :

  Rat Vascular Endothelial Growth Factor120 (VEGF120), a 14.1 kDa protein consisting of 120 amino acid residues, is produced as a homodimer. VEGF120 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF120 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1) . Consistent with the endothelial cell-specific action of VEGF120, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120, VEGF144 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. All dimeric forms possess similar biological activities. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities. The full ORF of native rat VEGF120 (Ala27-Arg146) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols.

• Synonyms :

  Vascular Endothelial Growth Factor A; Vegfa; Vegf; VEGF120

• NCBI Gene ID :

  83785

• UniProt :

  P16612

• Accession Number :

  NP_114024.2.

• Accession Number mRNA :

  NM_031836.2

• Reactivity :

  Rat

• Cross Reactivity :

  Rat

• Sequence :

  APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR

• Assay Protocol :

  The lyophilized VEGF120 should be reconstituted in ddH2O to a concentration not lower than 50µg/ml.

• Purity :

  > 90% by SDS-PAGE

• Bioactivity :

  Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 2-10 ng/ml.

• Length :

  120

• Form :

  Lyophilized (freeze-dried)

• Buffer :

  PBS

• Reconstitution :

  Water

• Molecular Weight :

  14.02 kDa

• Storage Conditions :

  Lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted VEGF120 should be stored in working aliquots at -20°C.

• Host or Source :

  E. coli

• N Terminal Sequence :

  APTTEGEQKAH