TPO (Animal Free)

• Description:

  TPO is a lineage-specific growth factor produced in the liver, kidney and skeletal muscle. It stimulates the proliferation and maturation of megakaryocytes, and promotes increased circulating levels of platelets in vivo. TPO signals through the c-mpl receptor, and acts as an important regulator of circulating platelets. Human and murine TPO exhibit cross-species reactivity. Recombinant Murine TPO is a fully biologically active 174 amino acid polypeptide (18.7 kDa), which contains the erythropoietin-like domain of the full length TPO protein.

• Synonyms:

  TPO, Thrombopoietin, MGDF, Megakaryocyte colony-stimulating factor, c-MPL Ligand

• NCBI Gene ID:

  21832

• UniProt:

  P40226

• Accession Number:

  NP_033405.1

• Accession Number mRNA:

  NM_009379.3

• Chromosomal Location:

  12 C; 12 15.0 cM

• Reactivity:

  Mouse

• Cross Reactivity:

  Human, Mouse

• Sequence:

  SPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF

• Endotoxin:

  < 0.01 ng/µg of protein (< 0.1 EU/µg)

• Purity:

  ≥ 98% by SDS-PAGE gel and HPLC analyses.

• Bioactivity:

  The ED50 as determined by the dose-dependent stimulation of the proliferation of human MO7e cells was found to be ≤ 1.0 ng/ml, corresponding to a specific activity of ≥ 1 x 106 units/mg.

• Length:

  174

• Form:

  Lyophilized

• Molecular Weight:

  18.7 kDa

• Host or Source:

  E. coli