PlGF Recombinant Protein
CAT:
209-M30-019S
Size:
2 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
PlGF Recombinant Protein
- Description: Placenta growth factor (PlGF) is a member of the vascular endothelial growth factor (VEGF) family of growth factors. PlGF and VEGF share primary structural as well as limited amino acid sequence homology with the A and B chains of PDGF. All eight cysteine residues involved in intra and interchain disulfides are conserved among these growth factors. As a result of alternative splicing, three PlGF RNAs encoding monomeric human PlGF-1, PlGF-2 and PlGF-3 isoform precursors containing 149, 179 and 219 amino acid residues, respectively, have been described. In normal mouse tissues, only one mouse PlGF mRNA encoding the equivalent of human PlGF-2 has been identified. Mouse PlGF shares 65% amino acid identity with human PlGF-2. The gene for PlGF has been mapped to mouse chromosome 12 and human chromosome 14. PlGF binds with high affinity to Flt1, but not to Flk1/KDR.
- Synonyms: Pgf; PlGF; Plgf; AI854365; placental growth factor
- CAS Number: 9000-83-3
- NCBI Gene ID: 18654
- UniProt: P49764
- Accession Number: NP_032853
- Accession Number mRNA: NM_008827
- Gene Location: 12 D; 12 39.0 cM
- Host: Insect Cells
- Origin Species: Mouse
- Species Reactivity: Mouse
- Sequence: ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
- Detection Range: Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant mouse PlGF can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL.
- Purity: > 95% by SDS-PAGE
- Length: 135/132
- Form: Lyophilized
- Buffer: 25 mM Tris, 75 mM NaCl pH 8.5
- Reconstitution: Centrifuge vial prior to opening. The lyophilised PlGF is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use.
- Molecular Weight: ~40 kDa
- Shipping Conditions: Room Temperature
- Storage Conditions: The lyophilized mouse PIGF, though stable at room temperature, is best stored in working aliquots at -20°C to -70°C.