PDGF-BB

CAT:
209-200-056
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
PDGF-BB - image 1

PDGF-BB

  • Description:

    PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet alpha-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-alpha and PDGFR-beta. PDGFR-alpha is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-beta interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-BB is a 24.3 kDa disulfide-linked homodimer of two B chains (218 total amino acids) .
  • Synonyms:

    PDGF-2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; Proto-oncogene c-Sis; INN=Becaplermin
  • NCBI Gene ID:

    5155
  • UniProt:

    P01127
  • Accession Number:

    NP_002599.1
  • Accession Number mRNA:

    NM_002608.2
  • Chromosomal Location:

    22q13.1
  • Reactivity:

    Human
  • Cross Reactivity:

    Human
  • Sequence:

    SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
  • Assay Protocol:

    Centrifuge vial prior to opening. The lyophilized PDGF-BB should be reconstituted in 50mM acetic acid to a concentration not lower than 100μg/ml. For long term storage of reconstituted protein addition of carrier protein (e.g. BSA or HSA; 0.1%) is recommended.
  • Endotoxin:

    < 0.1 ng per ug of PDGF-BB
  • Purity:

    > 95% by SDS-PAGE
  • Bioactivity:

    The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts) .
  • Length:

    109
  • Form:

    Lyophilized
  • Buffer:

    50mM acetic acid
  • Reconstitution:

    50mM acetic acid
  • Molecular Weight:

    24.3 kDa
  • Storage Conditions:

    The lyophilized PDGF-BB is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-BB is best stored at -20°C to -70°C.
  • Host or Source:

    E. coli
  • N Terminal Sequence:

    SLGSL