PDGF-AB
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


PDGF-AB
Description :
PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet α-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-α and PDGFR-β. PDGFR-α is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-β interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-AB is a 25.5 kDa disulfide-linked dimer, consisting of one A chain and one B chains (234 total amino acids) .Synonyms :
PDGFA; PDGF1; PDGF-ANCBI Gene ID :
5154/5155UniProt :
P04085/P01127Accession Number :
NP_002599.1; NP_002598.2Accession Number mRNA :
NM_002608.2; NM_002607.5Chromosomal Location :
7p22/22q13.1Reactivity :
HumanCross Reactivity :
HumanSequence :
Alpha chain: SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT Beta chain: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTAssay Protocol :
Centrifuge vial prior to opening. The lyophilized PDGF-AB should be reconstituted in 50mM acetic acid to a concentration not lower than 100μg/ml. For long term storage of reconstituted protein addition of carrier protein (e.g. BSA or HSA; 0.1%) is recommended.Endotoxin :
< 0.1 ng per ug of PDGF-ABPurity :
> 95% by SDS-PAGEBioactivity :
The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts) .Length :
126/110Form :
LyophilizedBuffer :
50mM acetic acidReconstitution :
50mM acetic acidMolecular Weight :
25.5 kDaStorage Conditions :
The lyophilized PDGF-AB is stable for a few weeks at room temperature, but best stored at -20°C. Reconstituted PDGF-AB is best stored at -20°C to -70°C. Avoid repeated freeze-thaw cycles.Host or Source :
E. coli

