Lyve-1, soluble Recombinant Protein
CAT:
209-S01-028
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Lyve-1, soluble Recombinant Protein
- Description: A DNA sequence encoding the extracellular domain of human LYVE-1 (Met1 to Gly232) was fused to a C-terminal His-tag (6xHis) and expressed in insect cells. Based on N-terminal sequence analysis, the primary structure of recombinant mature sLYVE-1 starts at Ser24. sLYVE-1 has a calculated monomeric molecular mass of about 25 kDa but as a result of glycosylation, migrates at approximately 35 - 45 kDa under reducing conditions in SDS-PAGE. LYVE-1 has been identified as a major receptor for HA (extracellular matrix glycosaminoglycan hyaluronan) on the lymph vessel wall. The deduced amino acid sequence of LYVE-1 predicts a 322-residue type I integral membrane polypeptide 41% similar to the CD44 HA receptor with a 212-residue extracellular domain containing a single Link module the prototypic HA binding domain of the Link protein superfamily. Like CD44, the LYVE-1 molecule binds both soluble and immobilized HA. However, unlike CD44, the LYVE-1 molecule colocalizes with HA on the luminal face of the lymph vessel wall and is completely absent from blood vessels. Hence, LYVE-1 is the first lymph-specific HA receptor to be characterized and is a uniquely powerful marker for lymph vessels themselves.
- Synonyms: LYVE1; HAR; XLKD1; LYVE-1; CRSBP-1
- CAS Number: 9000-83-3
- NCBI Gene ID: 10894
- UniProt: Q9Y5Y7
- Accession Number: NP_006682
- Accession Number mRNA: NM_006691
- Gene Location: 11p15
- Host: Insect Cells
- Origin Species: Human
- Species Reactivity: Human
- Tag: His-Tag
- Sequence: SLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGHHHHHH
- Purity: > 95% by SDS-PAGE
- Length: 215
- Form: Lyophilized
- Buffer: PBS
- Reconstitution: The lyophilized sLYVE-1 is soluble in water and most aqueous buffers. The lyophilized sLYVE-1 should be reconstituted in PBS or medium to a concentration not lower than 50µg/ml.
- Molecular Weight: ~ 35.0 - 45.0 kDa
- Shipping Conditions: Room Temperature
- Storage Conditions: lyophilized samples are stable for greater than six months at -20°C to -70°C. Reconstituted sLYVE-1 should be stored in working aliquots at -20°C. Avoid repeated freeze-thaw cycles!