IL-1 beta Recombinant Protein

• Description:

  Interleukin-1 beta (IL-1beta) is produced by activated macrophages. IL-1beta stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1beta proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. IL-1 is a name that designates two pleiotropic cytokines, IL-1 alpha (IL1F1) and IL1 beta (IL1F2), which are the products of distinct genes. IL- 1 alpha and IL-1 beta are structurally related polypeptides that share approximately 21% amino acid (aa) identity in human. Both proteins are produced by a wide variety of cells in response to inflammatory agents, infections, or microbial endotoxins. While IL-1 alpha and IL-1 beta are regulated independently, they bind to the same receptor and exert identical biological effects. The human IL-1 beta cDNA encodes a 269 aa precursor. A 116 aa propeptide is cleaved intracellularly by the cysteine protease IL-1 beta converting enzyme (Caspase1/ICE) to generate the active cytokine. The mature human IL-1 beta shares 96% aa sequence identity with rhesus and 67% 78% with canine, cotton rat, equine, feline, mouse, porcine, and rat IL-1 beta. Human recombinant IL-1beta produced in E. coli is a non-glycosylated, IL-1 beta polypeptide chain containing 153 amino acids and having a molecular mass of 17.0 kDa.

• Synonyms:

  IL1B; IL-1; IL1F2; IL1-BETA

• NCBI Gene ID:

  3553

• UniProt:

  P01584

• Accession Number:

  NP_000567

• Accession Number mRNA:

  NM_000576

• Gene Location:

  2q14

• Host:

  E. coli

• Origin Species:

  Human

• Species Reactivity:

  Human

• Sequence:

  APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

• Detection Range:

  Measured in a cell proliferation assay using murine D10G4.1 cells. The ED50 for this effect is typically 2-10 pg/ml.

• Endotoxin:

  < 0.1 ng per µg (IEU/µg) of rh IL-1ß

• Purity:

  > 98% by SDS-PAGE

• Length:

  153

• Form:

  Lyophilized

• Buffer:

  PBS

• Reconstitution:

  The lyophilized rh IL-1ß is soluble in water and most aqueous buffers and can be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted into other buffered solutions or stored at -20°C for future use.

• Molecular Weight:

  17.0 kDa

• Shipping Conditions:

  Room Temperature

• Storage Conditions:

  Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freeze-thaw cycles.

• N Terminal Sequence:

  APVRSL and MAPVRS

• CAS Number:

  9000-83-3