CNTF Recombinant Protein
CAT:
209-R20-001S
Size:
5 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

CNTF Recombinant Protein
- Description: Ciliary neurotrophic factor (CNTF) is a polypeptide initially purified from chick embryo ocular tissue and identified as a trophic factor for embryonic chick ciliary parasympathetic neurons in culture. Subsequent studies have demonstrated that CNTF is a survival factor for additional neuronal cell types including: primary sensory neurons, motor neurons, basal forebrain neurons and type 2 astrocytes. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. The cDNA for CNTF encodes a 200 amino acid residue polypeptide that lacks a signal sequence. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL6, IL11, LIF, and OSM. All of these four helix bundle cytokines share gp130 as a signal-transducing subunit in their receptor complexes. The cDNA for recombinant rat CNTF (Ala2–Met200) was cloned from total RNA of a rat embryo using standard protocols. Ciliary Neurotrophic Factor (CNTF) is a potent neural factor that was originally characterized as a survivability factor for chick ciliary neurons in vitro. More recently, CNTF has been shown to promote survivability and differentiation of other neuronal cell types. Rat CNTF is a 22.7 kDa protein containing 199 amino acid residues.
- Synonyms: Cntf
- CAS Number: 9000-83-3
- NCBI Gene ID: 25707
- UniProt: P20294
- Accession Number: NP_037298.1
- Accession Number mRNA: NM_013166.1
- Gene Location: 1q43
- Host: E. coli
- Origin Species: Rat
- Species Reactivity: Rat
- Sequence: AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
- Detection Range: Measured in a cell proliferation assay using TF1 human erythroleukemic cells [Kitamura T et al, J Cell Physiol 140, 1989). The ED50 for this effect is typically 3 - 15 ng/mL.
- Endotoxin: < 0.1 ng per µg of CNTF
- Purity: > 98% by SDS-PAGE
- Length: 199
- Form: Lyophilized
- Buffer: 5 mM sodium acetate, pH 6.5
- Reconstitution: Rat CNTF should be reconstituted in PBS to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffered solutions.
- Molecular Weight: 22.7 K kDa
- Shipping Conditions: Room Temperature
- Storage Conditions: The lyophilized powder although stable at room temperature for 3 weeks, is best stored desiccated at -20°C. Reconstituted rat CNTF should be stored in working aliquots at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).