CNTF

CAT:
209-R20-001S
Size:
5 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
CNTF - image 1

CNTF

  • Description :

    Ciliary neurotrophic factor (CNTF) is a polypeptide initially purified from chick embryo ocular tissue and identified as a trophic factor for embryonic chick ciliary parasympathetic neurons in culture. Subsequent studies have demonstrated that CNTF is a survival factor for additional neuronal cell types including: primary sensory neurons, motor neurons, basal forebrain neurons and type 2 astrocytes. CNTF has also been shown to prevent the degeneration of motor axons after axotomy. The cDNA for CNTF encodes a 200 amino acid residue polypeptide that lacks a signal sequence. CNTF is highly conserved across species and exhibits cross-species activities. Human and rat CNTF share approximately 83% homology in their protein sequence. CNTF is structurally related to IL6, IL11, LIF, and OSM. All of these four helix bundle cytokines share gp130 as a signal-transducing subunit in their receptor complexes. The cDNA for recombinant rat CNTF (Ala2–Met200) was cloned from total RNA of a rat embryo using standard protocols. Ciliary Neurotrophic Factor (CNTF) is a potent neural factor that was originally characterized as a survivability factor for chick ciliary neurons in vitro. More recently, CNTF has been shown to promote survivability and differentiation of other neuronal cell types. Rat CNTF is a 22.7 kDa protein containing 199 amino acid residues.
  • Synonyms :

    Cntf
  • NCBI Gene ID :

    25707
  • UniProt :

    P20294
  • Accession Number :

    NP_037298.1
  • Accession Number mRNA :

    NM_013166.1
  • Chromosomal Location :

    1q43
  • Reactivity :

    Rat
  • Cross Reactivity :

    Rat
  • Sequence :

    AFAEQTPLTLHRRDLCSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
  • Assay Protocol :

    Rat CNTF should be reconstituted in PBS to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffered solutions.
  • Endotoxin :

    < 0.1 ng per µg of CNTF
  • Purity :

    > 98% by SDS-PAGE
  • Bioactivity :

    Measured in a cell proliferation assay using TF1 human erythroleukemic cells [Kitamura T et al, J Cell Physiol 140, 1989) . The ED50 for this effect is typically 3 - 15 ng/mL.
  • Length :

    199
  • Form :

    Lyophilized
  • Buffer :

    5 mM sodium acetate, pH 6.5
  • Reconstitution :

    PBS
  • Molecular Weight :

    22.7 K kDa
  • Storage Conditions :

    The lyophilized powder although stable at room temperature for 3 weeks, is best stored desiccated at -20°C. Reconstituted rat CNTF should be stored in working aliquots at -20°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .
  • Host or Source :

    E. coli
  • N Terminal Sequence :

    AFAEQTPLTHR

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide