CD34, soluble Recombinant Protein
CAT:
209-S01-069
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

CD34, soluble Recombinant Protein
- Description: CD34 is a highly glycosylated type I membrane protein that is selectively expressed on hematopoietic stem cells and vascular endothelium. It has been widely used as a molecular marker for the identification, isolation, and manipulation of hemopoietic stem cells and progenitors. CD34 can function as a regulator of hemopoietic cell adhesion by mediating the attachment of stem cells to bone marrow stromal cells or other bone marrow components. The full length human CD34 is a 385 amino acid protein, consisting of a 31 amino acid signal sequence, a 74 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain and a 259 amino acid extracellular domain. Recombinant human sCD34 is a 258 amino acid polypeptide containing only the extracellular domain of the full length CD34 protein.
- Synonyms: CD34
- CAS Number: 9000-83-3
- NCBI Gene ID: 947
- UniProt: P28906
- Accession Number: NP_001764.1
- Accession Number mRNA: NM_001773.2
- Gene Location: 1q32
- Host: E. coli
- Origin Species: Human
- Species Reactivity: Human
- Tag: His-Tag
- Sequence: SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLEHHHHHH
- Detection Range: Data not available.
- Purity: > 95% by SDS-PAGE
- Length: 267
- Form: Lyophilized
- Molecular Weight: 28.6 kDa
- Shipping Conditions: Room Temperature