CD34, soluble Recombinant Protein

CD34, soluble Recombinant Protein

• Description: CD34 is a highly glycosylated type I membrane protein that is selectively expressed on hematopoietic stem cells and vascular endothelium. It has been widely used as a molecular marker for the identification, isolation, and manipulation of hemopoietic stem cells and progenitors. CD34 can function as a regulator of hemopoietic cell adhesion by mediating the attachment of stem cells to bone marrow stromal cells or other bone marrow components. The full length human CD34 is a 385 amino acid protein, consisting of a 31 amino acid signal sequence, a 74 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain and a 259 amino acid extracellular domain. Recombinant human sCD34 is a 258 amino acid polypeptide containing only the extracellular domain of the full length CD34 protein.
• Synonyms: CD34
• CAS Number: 9000-83-3
• NCBI Gene ID: 947
• UniProt: P28906
• Accession Number: NP_001764.1
• Accession Number mRNA: NM_001773.2
• Gene Location: 1q32
• Host: E. coli
• Origin Species: Human
• Species Reactivity: Human
• Tag: His-Tag
• Sequence: SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKTLEHHHHHH
• Detection Range: Data not available.
• Purity: > 95% by SDS-PAGE
• Length: 267
• Form: Lyophilized
• Molecular Weight: 28.6 kDa
• Shipping Conditions: Room Temperature