BMP-4

• Description:

  Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-β superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body and are involved in diverse physiological processes during both pre- and postnatal life. Like BMP-7, BMP-4 is involved in the development and maintenance of bone and cartilage. Reduced expression of BMP-4 is associated with a number of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. This E.coli derived murine BMP-4 is a fully active homodimeric protein consisting of two 106 amino acid subunits which correspond to amino acids 303-408 of the full length BMP-4 precursor.

• Synonyms:

  Bmp4; bone morphogenetic protein 4; Bmp-4; Bmp2b; Bmp2b1; Bmp2b-1

• NCBI Gene ID:

  12159

• UniProt:

  P21275

• Accession Number:

  NP_031580

• Accession Number mRNA:

  NM_007554

• Chromosomal Location:

  14 C1; 14 15.0 cM

• Reactivity:

  Mouse

• Cross Reactivity:

  Mouse

• Sequence:

  KKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

• Endotoxin:

  < 0.1 ng/µg of protein (< 1EU/µg)

• Purity:

  >98% by SDS-PAGE & HPLC analysis

• Bioactivity:

  Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells. The expected ED50 for this effect is 5-15 ng/ml.

• Length:

  106

• Form:

  Lyophilized

• Buffer:

  10mM Citric Acid

• Reconstitution:

  10mM Citric Acid

• Molecular Weight:

  23.9 kDa

• Storage Conditions:

  The lyophilized protein is stable at room temperature for 1 month and at 4°C for 6 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.

• Host or Source:

  E. coli