Angiopoietin-like protein 3 Recombinant Protein

Angiopoietin-like protein 3 Recombinant Protein

• Description: ANGPTL-3 (Angiopoietin like protein 3) is a member of the angiopoietin family of structurally related proteins, characterized by a coiled N-terminal domain and a C-terminal fibrinogen like domain. It is primarily expressed in the liver and can exert activities related to both angiogenesis and lipid metabolism. ANGPTL-3 inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), which has the effect of increasing plasma levels of triglycerides and HDL associated cholesterol. The fibrinogen like portion of the ANGPTL-3 protein can bind alpha-5/beta-3 integrins leading to endothelial cell adhesion and migration.  Recombinant human ANGPTL-3 is a glycoprotein that migrates by SDS-PAGE analysis at an apparent molecular weight of 62 kDa, and contains 452 amino acid residues including a C-terminal His tag.
• Synonyms: ANGPTL-3, ANG-5, ANGPT5
• CAS Number: 9000-83-3
• NCBI Gene ID: 27329
• UniProt: Q9Y5C1
• Accession Number: NP_055310.1
• Accession Number mRNA: NM_014495.3
• Gene Location: 1p31.3
• Host: CHO
• Origin Species: Human
• Species Reactivity: Human
• Tag: His-Tag
• Sequence: SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEHHHHHHHH
• Detection Range: Measured by its binding ability to recombinant αvβ3 integrin in a functional ELISA.
• Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
• Purity: > 97% by SDS-PAGE & HPLC analyses
• Length: 452
• Form: Lyophilized
• Molecular Weight: 62 kDa
• Shipping Conditions: Room Temperature