Angiopoietin-2 / Ang-2 Recombinant Protein
CAT:
209-300-050
Size:
20 µg
Price:
Ask
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No

Angiopoietin-2 / Ang-2 Recombinant Protein
- Description: ANG-2 binds to the endothelial cell specific receptor Tie-2, but, in contrast to ANG-1, does not induce tyrosine phosphorylation. Consequently, ANG-2 modulates ANG-1 activation of Tie-2 and, depending on the physiological and biochemical environment, can act either as an agonist or antagonist of Tie-2 induced angiogenesis. The signaling interactions of ANG-1, ANG-2 and Tie-2, along with less characterized ANG-3 and ANG-4, are required for embryonic and adult angiogenesis. Physiologically, ANG-1 and ANG-2 are associated with sprouting, tube formation, and structural integrity of newly formed blood vessels. Mature human ANG-2 is a secreted protein containing 480 amino acid residues. ANG-2 is composed of an alpha-helix-rich "coiled coil" N-terminal domain and fibrinogen-like C-terminal domain. ANG-2 exists predominantly in the form of a disulfide-linked dimer. Recombinant Human ANG-2 is a C-terminal histidine-tagged glycoprotein which migrates with an apparent molecular mass of 60.0-70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows an N-terminal sequence starting with residue 68 (D) of the ANG-2 precursor protein. The calculated molecular weight of Recombinant Human ANG-2 is 50.1 kDa.
- Synonyms: ANGPT2; ANG2; AGPT2
- CAS Number: 9000-83-3
- NCBI Gene ID: 285
- UniProt: Q15123
- Accession Number: NP_001138
- Accession Number mRNA: NM_001147.2
- Gene Location: 8p23.1
- Host: CHO
- Origin Species: Human
- Species Reactivity: Human
- Tag: His-Tag
- Sequence: DAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADFHHHHHH
- Detection Range: Determined by its ability to stimulate tubulogenesis in HUVEC cells using a concentration of 0.2 μg/ml
- Endotoxin: < 0.1 ng/µg of protein (<1EU/µg)
- Purity: > 95% by SDS-PAGE & HPLC analyses
- Length: 435
- Form: Lyophilized
- Buffer: 10 mM Sodium Phosphate, pH 8.0
- Reconstitution: Centrifuge the vial prior to opening. Reconstitute in water to a concentration of 0.1-1.0 mg/ml. Do not vortex. This solution can be stored at 2-8°C for up to 1 week. For extended storage, it is recommended to further dilute in a buffer containing a carrier protein (example 0.1% BSA) and store in working aliquots at -20°C to -80°C.
- Molecular Weight: 60.0-70.0 kDa
- Shipping Conditions: Room Temperature
- Storage Conditions: The lyophilized protein is stable at room temperature for 1 month and at 4°C for 3 months. Reconstituted working aliquots are stable for 1 week at 2°C to 8°C and for 3 months at -20°C to -80°C.