RegisterLogin

Mouse anti Integrin alpha 3A

CAT: 0579-MUB0901PSize: 0.1 mgDry Ice: NoHazardous: No
CAT#:0579-MUB0901PSize:0.1 mg
Selected
PRICE
AVAILABILITY: InStock
24/48H Stock Items & 2 to 6 Weeks non Stock Items.
Product image 1
1 / 1
Background
Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated α and β subunits. More than 18 α and 8 β subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits α3 and α6, two cytoplasmic variants, A and B, have been identified.
CAS Number
9007-83-4
UniProt
P26006
Host
Mouse
Species Reactivity
Human
,
Canine
Isotype
IgG2a
Clone
158A3
Type
Primary Antibodies
Source
158A3 is a Mouse monoclonal IgG2a antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Applications
ICC, IHC (frozen), WB
Field of Research
Cancer, Cell adhesion
Assay Principle
158A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration.
Form
Each vial contains 100 µL 1 mg/mL purified monoclonal antibody in PBS containing 0,09% sodium azide
Precautions
This product is intended FOR RESEARCH USE ONLY, and FOR TESTS IN VITRO, not for use in diagnostic or therapeutic procedures involving Humans or animals. This product contains sodium azide. To prevent formation of toxic vapors, do not mix with strong acidic solutions. To prevent formation of potentially explosive metallic azides in metal plumbing, always wash into drain with copious quantities of water. This datasheet is as accurate as reasonably achievable, but Nordic-MUbio accepts no liability for any inaccuracies or omissions in this information.
References & Citations
1. Delwel, G. O., de Melker, A. A., Hogervorst, F., Jaspars, L. H., Fles, D. L., Kuikman, I., Lindblom, A., Paulsson, M., Timpl, R., and Sonnenberg, A. (1994). Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms, Mol Biol Cell 5, 203-15. _x000D_ 2. de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.
Storage Conditions
The antibody is shipped at ambient temperature and may be stored at +4°C; For prolonged storage prepare appropriate aliquots and store at or below -20°C; Prior to use, an aliquot is thawed slowly in the dark at ambient temperature, spun down again and used to prepare working dilutions by adding sterile phosphate buffered saline (PBS, pH 7.2); Repeated thawing and freezing should be avoided; Working dilutions should be stored at +4°C, not refrozen, and preferably used the same day; If a slight precipitation occurs upon storage, this should be removed by centrifugation; It will not affect the performance or the concentration of the product

Related Products

CatalogName
MUB0905PMouse anti Integrin alpha 6B
MUB0903PMouse anti Integrin alpha 3B + alpha 6B
MUB0910PMouse anti Integrin alpha 5 (CD49e)
MUB2056PMouse anti CD11a, Integrin alpha-L
MUB0902PMouse anti Integrin alpha 3B (CD49c)
MUB1317PMouse anti Nesprin-3a
MUB0908PRat anti Integrin alpha 6A / CD49f
MUB0906PMouse anti Integrin beta 1D
MUB0907PMouse anti Integrin beta 1D
F115PSheep anti EBNA 3A

Alternative Products

CatalogName
MBS570064-01Mouse anti Integrin alpha 3A
MBS570179-01Mouse anti Integrin alpha 6B
MBS570101-01Mouse anti Integrin alpha 3B
MBS570088-01Mouse anti Integrin alpha 3B + alpha 6B
STJ72472Anti-Integrin alpha 11 (mouse) antibody
MBS570237-01Mouse anti Integrin alpha 5 (CD49e)
MBS570317-01Mouse anti CD11a, Integrin alpha-L
STJ93727Anti-Integrin alpha antibody
YF-PA12788anti-Integrin alpha V
YF-PA12761anti-Integrin alpha 6

Popular Products