CNTF Protein

• Gene Aliases:

  HCNTF, CNTF, Ciliary Neurotrophic Factor, CNTF Rat, Ciliary Neurotrophic Factor Rat Recombinant

• Gene ID:

  25707

• Accession Number:

  NP_037298.1

• Reactivity:

  Rat

• Target:

  Recombinant Rat Ciliary Neurotrophic Factor

• Type:

  Protein

• Sequence:

  AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM.

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Lyophilized from a concentrated (1mg/ml) solution in water containing 0.025% NaHCO3. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

• Reconstitution:

  Lyophilized CNTF although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution CNTF should be stored at 4C between 2-7 days and for future use below -18C. Please prevent freeze-thaw cycles.

• Notes:

  Formerly GWB-F0BBC9

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  RCNTF

• Host or Source:

  E. Coli

• Protein Name:

  Ciliary neurotrophic factor

• Gene Name URL:

  RCNTF