Eotaxin 2 Protein
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No


Eotaxin 2 Protein
Gene Aliases :
Ckb-6, MPIF2, MPIF-2, SCYA24Gene ID :
6369Accession Number :
NP_002982.2Reactivity :
HumanTarget :
Recombinant Human Eotaxin-2 (CCL24)Type :
ProteinSequence :
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.Assay Protocol :
Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) ProtocolFormat :
The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.Reconstitution :
Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution CCL24 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.Notes :
Formerly GWB-43BC9BProtein Length :
RecombinantNCBI Gene Symbol :
EOTAXIN 2Host or Source :
E. ColiProtein Name :
C-C motif chemokine 24Gene Name URL :
Eotaxin 2

