Eotaxin 2 Protein

CAT:
247-OPPA01593-5UG
Size:
5 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No
Eotaxin 2 Protein - image 1

Eotaxin 2 Protein

  • Gene Aliases :

    Ckb-6, MPIF2, MPIF-2, SCYA24
  • Gene ID :

    6369
  • Accession Number :

    NP_002982.2
  • Reactivity :

    Human
  • Target :

    Recombinant Human Eotaxin-2 (CCL24)
  • Type :

    Protein
  • Sequence :

    VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.
  • Assay Protocol :

    Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol
  • Format :

    The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
  • Reconstitution :

    Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution CCL24 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.
  • Notes :

    Formerly GWB-43BC9B
  • Protein Length :

    Recombinant
  • NCBI Gene Symbol :

    EOTAXIN 2
  • Host or Source :

    E. Coli
  • Protein Name :

    C-C motif chemokine 24
  • Gene Name URL :

    Eotaxin 2

Featured Selection

Popular Products

Discover our most sought-after biotechnology products, trusted by researchers worldwide