Eotaxin 2 Protein

• Gene Aliases:

  Ckb-6, MPIF2, MPIF-2, SCYA24

• Gene ID:

  6369

• Accession Number:

  NP_002982.2

• Reactivity:

  Human

• Target:

  Recombinant Human Eotaxin-2 (CCL24)

• Type:

  Protein

• Sequence:

  VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWV QRYMKNLDAKQKKASPRARAVA.

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride. Physical appearance: Sterile Filtered White lyophilized (freeze-dried) powder.

• Reconstitution:

  Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution CCL24 should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.

• Notes:

  Formerly GWB-43BC9B

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  EOTAXIN 2

• Host or Source:

  E. Coli

• Protein Name:

  C-C motif chemokine 24

• Gene Name URL:

  Eotaxin 2