UBE2M Protein

• Gene Aliases :

  UBC12, hUbc12, UBC-RS2

• Gene ID :

  9040

• Accession Number :

  NP_003960.1

• Reactivity :

  Human

• Target :

  Recombinant Human Ubiquitin Conjugating Enzyme E2M

• Type :

  Protein

• Sequence :

  MSYYHHHHHHDYDIPTTENLYFQGAMDPEFRIWMIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK.

• Assay Protocol :

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format :

  Lyophilized from a 0.2um filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5. Physical appearance: Sterile Filtered whilte lyophilized powder.

• Reconstitution :

  Lyophilized UBE2M although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution UBE2M should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0. 1% HSA or BSA) . Please prevent freeze-thaw cycles.

• Notes :

  Formerly GWB-F14281

• Protein Length :

  Recombinant

• NCBI Gene Symbol :

  UBE2M

• Host or Source :

  E. Coli

• Protein Name :

  NEDD8-conjugating enzyme Ubc12

• Gene Name URL :

  UBE2M