LY6E Recombinant Protein (Mouse)

• Gene Name:

  Lymphocyte antigen 6 complex, locus E

• Gene Aliases:

  Ly6; Ly67; lymphocyte antigen 6E; RIG; RIG-E; Sca; Sca-2; stem cell antigen 2; thymic shared antigen 1; Ts; TSA; Tsa1; TSA-1.

• Gene ID:

  17069

• Accession Number:

  NP_001157508

• Reactivity:

  Mouse|Mus musculus

• Target:

  Involved in T-cell development (PubMed:8258699) . Believed to act as a modulator of nicotinic acetylcholine receptors (nAChRs) activity. In vitro inhibits alpha-3:beta-4-containing nAChRs maximum response (PubMed:26276394) .

• Type:

  Protein

• Source:

  E.coli

• Sequence:

  LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

• Assay Protocol:

  Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

• Format:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  -20°C or -80°C

• Molecular Weight:

  22.8 kDa

• Protein Length:

  Recombinant

• NCBI Gene Symbol:

  Ly6e

• Protein Name:

  Lymphocyte antigen 6E

• Gene Name URL:

  Ly6e

• CAS Number:

  9000-83-3

• Nucleotide Accession Number:

  NM_001164036